DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1B and COPT4

DIOPT Version :9

Sequence 1:NP_649790.1 Gene:Ctr1B / 40989 FlyBaseID:FBgn0062412 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_850289.1 Gene:COPT4 / 818369 AraportID:AT2G37925 Length:145 Species:Arabidopsis thaliana


Alignment Length:169 Identity:37/169 - (21%)
Similarity:60/169 - (35%) Gaps:66/169 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 STSTAKSCP-----MIMVFHAGHCERILWRGWVASTVTEFVLSALAIFLVSFLYEALKFLRQQLA 67
            :|:|....|     :...|:.|:..::|:.||..|....:.|:.:.:|.::||.|       .||
plant    16 TTTTQTQTPHRPSLLHPTFYWGYNCQVLFSGWPGSDRGMYALALIFVFFLAFLAE-------WLA 73

  Fly    68 RREARRASEQLAAEQRRKNEAPAAGGCCSEAPLAEPREQTYWQRLFASSHIVQSLLNLLQIV--- 129
            |                          ||:|                 |.|.|....|.::.   
plant    74 R--------------------------CSDA-----------------SSIKQGADKLAKVAFRT 95

  Fly   130 --------ISYLLMLIFMTFNYWLCLAVILGLGLGYFFF 160
                    .|||::|..::||..:.||.|.|..||:..|
plant    96 AMYTVKSGFSYLVILAVVSFNGGVFLAAIFGHALGFAVF 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1BNP_649790.1 Ctr 17..160 CDD:282057 33/153 (22%)
COPT4NP_850289.1 Ctr 33..134 CDD:398012 33/150 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.