DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1B and COPT6

DIOPT Version :9

Sequence 1:NP_649790.1 Gene:Ctr1B / 40989 FlyBaseID:FBgn0062412 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_850091.1 Gene:COPT6 / 817239 AraportID:AT2G26975 Length:145 Species:Arabidopsis thaliana


Alignment Length:180 Identity:43/180 - (23%)
Similarity:71/180 - (39%) Gaps:50/180 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDHGSDDSTS--------TAKSCPMIMVFHAGHCERILWRGWVASTVTEFVLSALAIFLVSFLYE 57
            ||||:...:|        .:....|.|.|..|....||:.||..:::..:||..:.:||::.:.|
plant     1 MDHGNMPPSSPSSMVNHTNSNMIMMHMTFFWGKNTEILFSGWPGTSLGMYVLCLIVVFLLAVIVE 65

  Fly    58 ALKFLRQQLARREARRASEQLAAEQRRKNEAPAAGGCCSEAPLAEPREQTYWQRLFASSHIVQSL 122
                   .||.....|.         |.:.:.|.|                         :||:.
plant    66 -------WLAHSSILRG---------RGSTSRAKG-------------------------LVQTA 89

  Fly   123 LNLLQIVISYLLMLIFMTFNYWLCLAVILGLGLGYFFFGWNK-KNPDESE 171
            :..|:..::||:||..|:||..:.:..|.|..:|:..||... |||.:.|
plant    90 VYTLKTGLAYLVMLAVMSFNGGVFIVAIAGFAVGFMLFGSTAFKNPSDDE 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1BNP_649790.1 Ctr 17..160 CDD:282057 32/142 (23%)
COPT6NP_850091.1 Ctr 25..127 CDD:282057 32/142 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.