DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1B and slc31a2

DIOPT Version :9

Sequence 1:NP_649790.1 Gene:Ctr1B / 40989 FlyBaseID:FBgn0062412 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001185678.1 Gene:slc31a2 / 563012 ZFINID:ZDB-GENE-030925-25 Length:171 Species:Danio rerio


Alignment Length:168 Identity:43/168 - (25%)
Similarity:71/168 - (42%) Gaps:32/168 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MIMVFHAGHCERILWRGWVASTVTEFVLSALAIFLVSFLYEALKFLRQQLARREARRASEQLAAE 81
            |.|.|.......:|:..|........|||...:.|::.:||.||..:..:.::::...:....|.
Zfish     1 MNMYFEGSSNVTLLFNFWNVHGPAGMVLSVFVVLLLTVVYELLKVWKITVGKQKSSPNTSPSTAM 65

  Fly    82 QRRKNEAPAAGGC------CSE--APLAE--------PREQTYWQRLFASS----------HIVQ 120
            ...:|:.    .|      |.|  :.||.        |.|.|  .....||          |.:|
Zfish    66 SFSQNKQ----SCFATVIKCQEGSSSLANSPSEVSLTPTENT--DNAADSSTAAKRRRWILHCLQ 124

  Fly   121 SLLNLLQIVISYLLMLIFMTFNYWLCLAVILGLGLGYF 158
            :.::::|:.:.|:|||..|::|.|:.|.||.|..||||
Zfish   125 TAIHIVQVTLGYMLMLCVMSYNIWIFLGVITGSVLGYF 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1BNP_649790.1 Ctr 17..160 CDD:282057 43/168 (26%)
slc31a2NP_001185678.1 Ctr <116..163 CDD:282057 18/47 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590862
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4018
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.