DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1B and K12C11.6

DIOPT Version :9

Sequence 1:NP_649790.1 Gene:Ctr1B / 40989 FlyBaseID:FBgn0062412 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001076607.1 Gene:K12C11.6 / 4926921 WormBaseID:WBGene00045052 Length:132 Species:Caenorhabditis elegans


Alignment Length:145 Identity:47/145 - (32%)
Similarity:72/145 - (49%) Gaps:27/145 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MIMVFHAGHCERILWRGWVASTVTEFVLSALAIFLVSFLYEALKFLRQQLARREARRASEQLAAE 81
            |.|.||....:.:|::.|..:.....|.....|.:...|.|.:||||.::              |
 Worm     9 MHMWFHTKTQDTVLFKTWNVTDTPTMVWVCCIIVVAGILLELIKFLRWKI--------------E 59

  Fly    82 QRRKNEAPAAGGCCSEAPLAEPREQTYWQRLFASSHIVQSLLNLLQIVISYLLMLIFMTFNYWLC 146
            :..||.             .|...::|..|||:..||.|::|.::|:..||:|||:||||:.||.
 Worm    60 KWHKNR-------------DELVSRSYISRLFSPIHIGQTILFMVQLSFSYILMLLFMTFSVWLG 111

  Fly   147 LAVILGLGLGYFFFG 161
            :||::|||:||..||
 Worm   112 IAVVVGLGIGYLAFG 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1BNP_649790.1 Ctr 17..160 CDD:282057 45/142 (32%)
K12C11.6NP_001076607.1 Ctr 9..125 CDD:282057 45/142 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D564753at33208
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104136
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.