DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1B and K12C11.7

DIOPT Version :9

Sequence 1:NP_649790.1 Gene:Ctr1B / 40989 FlyBaseID:FBgn0062412 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001076608.1 Gene:K12C11.7 / 4926895 WormBaseID:WBGene00045053 Length:166 Species:Caenorhabditis elegans


Alignment Length:181 Identity:56/181 - (30%)
Similarity:78/181 - (43%) Gaps:45/181 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MIMVFHAGHCERILWRGWVASTVTEFVLSALAIFLVSFLYEALKFLRQQLARREARRASEQLAAE 81
            |.|.||....|.||:|.|..:..|.:|.|.:::|.::|..|.|||.||    |..|...|:||.:
 Worm     6 MQMYFHFRIQEPILFRQWKPTDTTGYVFSCISLFFIAFCLELLKFGRQ----RMTRTVKEKLAVD 66

  Fly    82 QRRKNEAPAAGGCCS---------EAPLAEPREQ------------TYWQRLFASSHIVQSLLNL 125
                       .|||         |.|...||.:            :.|:      |...|.|..
 Worm    67 -----------CCCSTPEGIWEIPEEPEPSPRGKLASLAPFTMESISSWR------HFASSFLFF 114

  Fly   126 LQIVISYLLMLIFMTFNYWLCLAVILGLGLGYFFFG---WNKKNPDESECC 173
            ||..:.|.|||:.||:||.|..:::.|..:||||.|   ..|:..:...||
 Worm   115 LQNFVDYSLMLVAMTYNYPLFFSLLAGHAIGYFFVGPLMTVKEVENTGNCC 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1BNP_649790.1 Ctr 17..160 CDD:282057 51/163 (31%)
K12C11.7NP_001076608.1 Ctr 9..148 CDD:282057 48/159 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29000
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.