DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1B and Ctr1C

DIOPT Version :9

Sequence 1:NP_649790.1 Gene:Ctr1B / 40989 FlyBaseID:FBgn0062412 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_651837.1 Gene:Ctr1C / 43668 FlyBaseID:FBgn0062411 Length:270 Species:Drosophila melanogaster


Alignment Length:219 Identity:70/219 - (31%)
Similarity:100/219 - (45%) Gaps:54/219 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HGSDDSTSTAKSCPMIMVFHAGHCERILWRGWVASTVTEFVLSALAIFLVSFLYEALKFLRQQL- 66
            ||..:  ..|....|.|.||.|..|.||::.|...:.....||.|.||:|:.|||||||.|:.| 
  Fly    51 HGHHE--GGAHDMSMAMFFHTGDSETILFKFWRTESAMALTLSCLLIFMVAVLYEALKFFREWLF 113

  Fly    67 ------------------ARREA--------------RRASEQLAAEQRRKNEAPAAGGCCSEAP 99
                              ..|||              :::..|:.|.:.|....|........:|
  Fly   114 SWDRKRLAGGRDQYNRPRRYREANYNYNQPTYPPRTNQQSGTQVYAYRPRSPSMPPLQPPGRSSP 178

  Fly   100 LAE------------------PREQTYWQRLFASS-HIVQSLLNLLQIVISYLLMLIFMTFNYWL 145
            .|:                  |..:|...::|.|. ||:|:.|::||::||:||||:|||||.||
  Fly   179 QAQSSLILTQHTHHHVQENTPPAGRTTKLKVFCSGMHILQTFLHVLQVLISFLLMLVFMTFNVWL 243

  Fly   146 CLAVILGLGLGYFFFGWNKKNPDE 169
            |:||:||.|:||:.|...:.|..|
  Fly   244 CVAVLLGAGVGYYIFCAFRTNVQE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1BNP_649790.1 Ctr 17..160 CDD:282057 64/194 (33%)
Ctr1CNP_651837.1 SelP_N <23..56 CDD:282453 2/6 (33%)
Ctr 63..258 CDD:282057 64/194 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435324
Domainoid 1 1.000 52 1.000 Domainoid score I4266
eggNOG 1 0.900 - - E1_KOG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2023
Isobase 1 0.950 - 0 Normalized mean entropy S2329
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130811at33392
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 1 1.000 - - otm14791
orthoMCL 1 0.900 - - OOG6_104136
Panther 1 1.100 - - P PTHR12483
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4018
SonicParanoid 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.