DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1B and slc31a1

DIOPT Version :9

Sequence 1:NP_649790.1 Gene:Ctr1B / 40989 FlyBaseID:FBgn0062412 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001001238.1 Gene:slc31a1 / 407919 XenbaseID:XB-GENE-994882 Length:183 Species:Xenopus tropicalis


Alignment Length:164 Identity:58/164 - (35%)
Similarity:88/164 - (53%) Gaps:20/164 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DHGSDDSTSTAKSCPMIMVFHAGHCE-RILWRGWVASTVTEFVLSALAIFLVSFLYEALKFLRQQ 65
            |||.....       |.|.|:.|:.. .:|:.|.|.::..|...:.:|:||::.|||.||..|:.
 Frog    28 DHGGSMHM-------MQMTFYFGYENVEVLFTGLVINSAGEMAGAFVAVFLLALLYEGLKISREA 85

  Fly    66 LARREARRASEQLAAEQRRKNEAPAAGGCCSEAPLAEPREQTYWQRLFASSHIVQSLLNLLQIVI 130
            |.|:      .|::.   |.|..|..|   ....:.....:|..||:.:..|::|:||:::|:|:
 Frog    86 LLRK------SQVSI---RYNSMPVPG---PNGTILMETHKTVGQRMLSVPHLLQTLLHIIQVVV 138

  Fly   131 SYLLMLIFMTFNYWLCLAVILGLGLGYFFFGWNK 164
            ||.|||||||:|.:||:||..|.|.|||.|.|.|
 Frog   139 SYFLMLIFMTYNAYLCIAVAAGAGTGYFLFSWKK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1BNP_649790.1 Ctr 17..160 CDD:282057 52/143 (36%)
slc31a1NP_001001238.1 Ctr 38..168 CDD:309321 51/141 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.