DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1B and Ctr1A

DIOPT Version :9

Sequence 1:NP_649790.1 Gene:Ctr1B / 40989 FlyBaseID:FBgn0062412 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001245552.1 Gene:Ctr1A / 31601 FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster


Alignment Length:177 Identity:64/177 - (36%)
Similarity:97/177 - (54%) Gaps:7/177 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DHGSDDSTSTAKSCPMIMVFHAGHCERILWRGWVASTVTEFVLSALAIFLVSFLYEALKFLRQQL 66
            :||....|......|  |.||.|:.|.||:..|...||...:.|.:||||::.:||.||:.|:.|
  Fly    66 NHGGGSGTGMEHMMP--MAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYL 128

  Fly    67 ARREARRASEQLAAEQRRKNEAP--AAGGCCSEAPLAEPREQTYWQ--RLFASSHIVQSLLNLLQ 127
            ..:.......:.....:|..|||  .:....:.:|:....|..:.|  .:.:.:|::|:||::||
  Fly   129 FWKTYNLLEYRPVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLSINHLLQTLLHVLQ 193

  Fly   128 IVISYLLMLIFMTFNYWLCLAVILGLGLGYFFFGWNKK-NPDESECC 173
            :.:|:||||||||:|.||||.|:||..:|||.|.|.|. ..|.:|.|
  Fly   194 VTLSFLLMLIFMTYNVWLCLMVVLGAAVGYFLFCWKKSVIVDVTEHC 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1BNP_649790.1 Ctr 17..160 CDD:282057 54/146 (37%)
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 55/148 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435323
Domainoid 1 1.000 52 1.000 Domainoid score I4266
eggNOG 1 0.900 - - E1_KOG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2590
Isobase 1 0.950 - 0 Normalized mean entropy S2329
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130811at33392
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 1 1.000 - - otm14791
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12483
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4018
SonicParanoid 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.