DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1B and F58G6.3

DIOPT Version :9

Sequence 1:NP_649790.1 Gene:Ctr1B / 40989 FlyBaseID:FBgn0062412 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_501713.1 Gene:F58G6.3 / 259943 WormBaseID:WBGene00010274 Length:134 Species:Caenorhabditis elegans


Alignment Length:161 Identity:44/161 - (27%)
Similarity:79/161 - (49%) Gaps:31/161 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDHGSDDSTSTAKSCPMIMVFHAGHCERILWRGWVASTVTEFVLSALAIFLVSFLYEALKFLRQQ 65
            |:|.|.|.... :...|.|.||....:.:|:..|..::..:.|.:.:.:.:...:.||:|:.|:.
 Worm     1 MNHNSMDMDMN-QGPFMWMWFHTKPQDTVLFSTWNITSAGKMVWACILVAIAGIILEAIKYNRRL 64

  Fly    66 LARREARRASEQLAAEQRRKNEAPAAGGCCSEAPLAEPREQTYWQRLFASSHIVQSLLNLLQIVI 130
            :                 :|.::|:             ::::|..||.::.|..|:.|..:|:..
 Worm    65 I-----------------QKRQSPS-------------KKESYISRLLSTMHFFQTFLFFVQLGF 99

  Fly   131 SYLLMLIFMTFNYWLCLAVILGLGLGYFFFG 161
            ||.||||||||:.||.|||::||.:|:..||
 Worm   100 SYCLMLIFMTFSIWLGLAVVIGLSIGFLIFG 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1BNP_649790.1 Ctr 17..160 CDD:282057 38/142 (27%)
F58G6.3NP_501713.1 Ctr 16..129 CDD:282057 38/142 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2329
OMA 1 1.010 - - QHG29000
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104136
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.740

Return to query results.
Submit another query.