DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1B and ctr6

DIOPT Version :9

Sequence 1:NP_649790.1 Gene:Ctr1B / 40989 FlyBaseID:FBgn0062412 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_595861.1 Gene:ctr6 / 2540641 PomBaseID:SPBC23G7.16 Length:148 Species:Schizosaccharomyces pombe


Alignment Length:164 Identity:44/164 - (26%)
Similarity:76/164 - (46%) Gaps:38/164 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDHGSDDSTSTAKSCPMIMVFHAGH---CERILWRGWVASTVTEFVLSALAIFLVSFLYEALK-- 60
            |:||.:   ||.:.|.|.|.|:..:   |  |:::.|....:::|:||.|||.::.:|:|.|:  
pombe     1 MNHGGN---STMRHCSMKMTFNTDYDNLC--IVFKSWHIGNLSQFLLSLLAIAILGYLFERLRSF 60

  Fly    61 --FLRQQLARREARRASEQLAAEQRRKNEAPAAGGCCSEAPLAEPREQTYWQRLFASSHIVQSLL 123
              ....:..|..|.:.||.|.....:..::......|:               |:|         
pombe    61 TSLKETEFQRGYAGQQSEGLLTHHSKSLKSGRPFRLCA---------------LYA--------- 101

  Fly   124 NLLQIVISYLLMLIFMTFNYWLCLAVILGLGLGY 157
              :|:|.||.|||:.||:|.::.||:.:|...||
pombe   102 --VQLVFSYFLMLVAMTYNAYVILAIAIGAAFGY 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1BNP_649790.1 Ctr 17..160 CDD:282057 38/148 (26%)
ctr6NP_595861.1 Ctr 14..133 CDD:282057 36/146 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2023
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4018
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.950

Return to query results.
Submit another query.