DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1B and Slc31a1

DIOPT Version :9

Sequence 1:NP_649790.1 Gene:Ctr1B / 40989 FlyBaseID:FBgn0062412 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_780299.2 Gene:Slc31a1 / 20529 MGIID:1333843 Length:196 Species:Mus musculus


Alignment Length:162 Identity:57/162 - (35%)
Similarity:86/162 - (53%) Gaps:16/162 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HGSDDSTSTAKSCPMIMVFHAGHCERILWRGWVASTVTEFVLSALAIFLVSFLYEALKFLRQQLA 67
            ||..||   ....||...|...:. .:|:.|.|.:|..|...:.:|:||::..||.||..|:.|.
Mouse    40 HGGGDS---MMMMPMTFYFDFKNV-NLLFSGLVINTPGEMAGAFVAVFLLAMFYEGLKIAREGLL 100

  Fly    68 RREARRASEQLAAEQRRKNEAPAAGGCCSEAPLAEPREQTYWQRLFASSHIVQSLLNLLQIVISY 132
            |:      .|::.   |.|..|..|   ....:.....:|..|::.:..|::|::|:::|:||||
Mouse   101 RK------SQVSI---RYNSMPVPG---PNGTILMETHKTVGQQMLSFPHLLQTVLHIIQVVISY 153

  Fly   133 LLMLIFMTFNYWLCLAVILGLGLGYFFFGWNK 164
            .|||||||:|.:||:||..|.|.|||.|.|.|
Mouse   154 FLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKK 185

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Ctr1BNP_649790.1 Ctr 17..160 CDD:282057 49/142 (35%)