DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1B and F31E8.4

DIOPT Version :9

Sequence 1:NP_649790.1 Gene:Ctr1B / 40989 FlyBaseID:FBgn0062412 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_495391.1 Gene:F31E8.4 / 174118 WormBaseID:WBGene00017954 Length:162 Species:Caenorhabditis elegans


Alignment Length:168 Identity:56/168 - (33%)
Similarity:83/168 - (49%) Gaps:19/168 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MIMVFHAGHCERILWRGWVASTVTEFVLSALAIFLVSFLYEALKFLRQQLA-----RREARRASE 76
            |.|..|.|..|:||:..|...:::...:|.|..||:..||||:|..|..||     :|:.|.|..
 Worm     3 MDMTLHFGEREKILFSWWKTGSLSGMAVSMLITFLLCILYEAIKSFRYFLAVWNNQKRQQRHAEA 67

  Fly    77 QLAAEQRRKNEAPAAGGCCSE-----APLAEPREQTYWQRLFASSHIVQSLLNLLQIVISYLLML 136
            .:.      |...:.|...||     |||.:  ...:.:|||.|..:.|..|..||.:::|.|||
 Worm    68 SIT------NPQNSGGDNISEDSIHIAPLVQ--LSGFTKRLFTSYRLAQGALYGLQALLAYTLML 124

  Fly   137 IFMTFNYWLCLAVILGLGLGYFFFGWNKKNPDE-SECC 173
            |.||:|..|.|::::|..:|||.|..|...... ::||
 Worm   125 IAMTYNMNLILSIVVGEAVGYFLFTGNPLVEQHLTDCC 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1BNP_649790.1 Ctr 17..160 CDD:282057 52/152 (34%)
F31E8.4NP_495391.1 Ctr 3..148 CDD:282057 52/152 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 87 1.000 Domainoid score I5094
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29000
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 1 1.000 - - otm14077
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.890

Return to query results.
Submit another query.