DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1B and F27C1.2

DIOPT Version :9

Sequence 1:NP_649790.1 Gene:Ctr1B / 40989 FlyBaseID:FBgn0062412 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001021419.1 Gene:F27C1.2 / 172196 WormBaseID:WBGene00017852 Length:256 Species:Caenorhabditis elegans


Alignment Length:178 Identity:56/178 - (31%)
Similarity:86/178 - (48%) Gaps:25/178 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HGSDDSTSTAKSCPMIMVFHAGHCERILWRGWVASTVTEFVLSALAIFLVSFLYEALKFLR---- 63
            |||.......:...|.|.||.|..|.||:..|...::...:||..|||::...||.:|:.|    
 Worm    62 HGSHAGHGGHEGHMMKMWFHGGFEEVILFDFWRTDSLFGMLLSCAAIFIMGATYEGVKWFRVFLQ 126

  Fly    64 --QQLARREARRASEQLAAEQRRKNEAPAAGGCC--------SEAPLAEP------REQTYWQRL 112
              |..|:..|.::..:.|.:..|     ::||.|        |..|.:||      ..:|.....
 Worm   127 MTQTQAQVLANKSCVEFALQTTR-----SSGGTCHQSVTHSQSNKPQSEPFLISASVARTPATSP 186

  Fly   113 FASSHIVQSLLNLLQIVISYLLMLIFMTFNYWLCLAVILGLGLGYFFF 160
            |:...::|.||.:.|:|::|.||||.||:|.:|..||:||.|.|::.|
 Worm   187 FSPQRLIQMLLYIFQLVLAYWLMLIVMTYNTYLTAAVVLGAGFGHWLF 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1BNP_649790.1 Ctr 17..160 CDD:282057 52/162 (32%)
F27C1.2NP_001021419.1 Ctr 76..234 CDD:282057 52/162 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156057
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 1 1.000 - - otm14791
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4018
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.980

Return to query results.
Submit another query.