DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1B and Slc31a1

DIOPT Version :9

Sequence 1:NP_649790.1 Gene:Ctr1B / 40989 FlyBaseID:FBgn0062412 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_598284.1 Gene:Slc31a1 / 171135 RGDID:620059 Length:187 Species:Rattus norvegicus


Alignment Length:176 Identity:59/176 - (33%)
Similarity:93/176 - (52%) Gaps:24/176 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDHGSDD---------STSTAKSCPMI--MVFHAGHCE-RILWRGWVASTVTEFVLSALAIFLVS 53
            |:|..|:         :||.:.|..|:  |.|:.|... .:|:...|.:|..|...:.:|:||::
  Rat    13 MNHTDDNITMPPHQHPTTSASHSHEMMMPMTFYFGFKNVDLLFSSLVINTPGEMAGAFVAVFLLA 77

  Fly    54 FLYEALKFLRQQLARREARRASEQLAAEQRRKNEAPAAGGCCSEAPLAEPREQTYWQRLFASSHI 118
            ..||.||..|:.|.|:      .|::.   |.|..|..|   ....:.....:|..|::.:..|:
  Rat    78 MFYEGLKIAREGLLRK------SQVSI---RYNSMPVPG---PNGTILMETHKTVGQQMLSFPHL 130

  Fly   119 VQSLLNLLQIVISYLLMLIFMTFNYWLCLAVILGLGLGYFFFGWNK 164
            :|::|:::|:||||.|||||||:|.:||:||..|.|.|||.|.|.|
  Rat   131 LQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKK 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1BNP_649790.1 Ctr 17..160 CDD:282057 50/145 (34%)
Slc31a1NP_598284.1 Ctr 42..172 CDD:398012 49/141 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.