DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1B and SLC31A1

DIOPT Version :9

Sequence 1:NP_649790.1 Gene:Ctr1B / 40989 FlyBaseID:FBgn0062412 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001850.1 Gene:SLC31A1 / 1317 HGNCID:11016 Length:190 Species:Homo sapiens


Alignment Length:163 Identity:58/163 - (35%)
Similarity:88/163 - (53%) Gaps:17/163 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HGSDDSTSTAKSCPMIMVFHAGHCE-RILWRGWVASTVTEFVLSALAIFLVSFLYEALKFLRQQL 66
            ||..||:...    |.|.|:.|... .:|:.|.|.:|..|...:.:|:||::..||.||..|:.|
Human    33 HGGGDSSMMM----MPMTFYFGFKNVELLFSGLVINTAGEMAGAFVAVFLLAMFYEGLKIARESL 93

  Fly    67 ARREARRASEQLAAEQRRKNEAPAAGGCCSEAPLAEPREQTYWQRLFASSHIVQSLLNLLQIVIS 131
            .|:      .|::.   |.|..|..|   ....:.....:|..|::.:..|::|::|:::|:|||
Human    94 LRK------SQVSI---RYNSMPVPG---PNGTILMETHKTVGQQMLSFPHLLQTVLHIIQVVIS 146

  Fly   132 YLLMLIFMTFNYWLCLAVILGLGLGYFFFGWNK 164
            |.|||||||:|.:||:||..|.|.|||.|.|.|
Human   147 YFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKK 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1BNP_649790.1 Ctr 17..160 CDD:282057 51/143 (36%)
SLC31A1NP_001850.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 1/1 (100%)
Ctr 45..175 CDD:398012 50/141 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2329
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4018
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.