DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7483 and AT1G72730

DIOPT Version :9

Sequence 1:NP_649788.2 Gene:CG7483 / 40987 FlyBaseID:FBgn0037573 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_177417.1 Gene:AT1G72730 / 843605 AraportID:AT1G72730 Length:414 Species:Arabidopsis thaliana


Alignment Length:397 Identity:253/397 - (63%)
Similarity:313/397 - (78%) Gaps:1/397 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RKNAQAEDLSNVEFETSEDVEVIPTFNAMNLKEELLRGIYAYGFEKPSAIQQRSITPIVKGRDVI 67
            :.||...:.....|.|:.| ||..:|:||.|:.:|||||||||||||||||||.|.|..||.|||
plant    19 KMNAILGEEGEETFYTNYD-EVCDSFDAMELQPDLLRGIYAYGFEKPSAIQQRGIIPFCKGLDVI 82

  Fly    68 AQAQSGTGKTATFSISILQSLDTTLRETQVLCLSPTRELAVQIQKVILALGDMMNVQCHVCIGGT 132
            .||||||||||||...:||.||.:|.:.|.|.|:||||||.||:||:.||||.:.|:...|:|||
plant    83 QQAQSGTGKTATFCSGVLQQLDISLVQCQALVLAPTRELAQQIEKVMRALGDYLGVKAQACVGGT 147

  Fly   133 NLGEDIRKLDYGQHIVSGTPGRVFDMIKRRVLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLP 197
            ::.||.|.|..|.|:|.||||||||:::|:.||..||||.|||||||||::|||:||||:::.||
plant   148 SVREDQRVLQSGVHVVVGTPGRVFDLLRRQSLRADAIKMFVLDEADEMLSRGFKDQIYDIFQLLP 212

  Fly   198 PATQVVLISATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDT 262
            ...||.:.|||:|.|.||:|.|||..|:|||||||||||||||||:|.|::||||.:||||||:|
plant   213 SKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYET 277

  Fly   263 LTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERDEIMKEFRAGQSRVLITTDVWAR 327
            |.|||:|||.||:|||||||:|||..:.|||:.||||.|..||.||:|||:|.||||||||:.||
plant   278 LAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLAR 342

  Fly   328 GIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDDIRILRDIEQYYSTQIDEMP 392
            ||||||||||||:|||...|.|:||||||||||||||||||:.|:|.|::.||:::|:..::|:|
plant   343 GIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFMTSEDERMMADIQRFYNVVVEELP 407

  Fly   393 MNVADLI 399
            .|||||:
plant   408 SNVADLL 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7483NP_649788.2 PTZ00424 4..399 CDD:185609 252/394 (64%)
AT1G72730NP_177417.1 PTZ00424 28..414 CDD:185609 250/386 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53631
OrthoDB 1 1.010 - - D726081at2759
OrthoFinder 1 1.000 - - FOG0000304
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X250
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.