DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7483 and EIF4A-2

DIOPT Version :9

Sequence 1:NP_649788.2 Gene:CG7483 / 40987 FlyBaseID:FBgn0037573 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_175829.1 Gene:EIF4A-2 / 841868 AraportID:AT1G54270 Length:412 Species:Arabidopsis thaliana


Alignment Length:385 Identity:258/385 - (67%)
Similarity:309/385 - (80%) Gaps:1/385 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EFETSEDVEVIPTFNAMNLKEELLRGIYAYGFEKPSAIQQRSITPIVKGRDVIAQAQSGTGKTAT 79
            ||.||.| ||..:|:||.|:|.|||||||||||||||||||.|.|..||.|||.|||||||||||
plant    29 EFFTSYD-EVHESFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTAT 92

  Fly    80 FSISILQSLDTTLRETQVLCLSPTRELAVQIQKVILALGDMMNVQCHVCIGGTNLGEDIRKLDYG 144
            |...:||.||..|.:.|.|.|:||||||.||:||:.||||...|:.|.|:|||::.||.|.|..|
plant    93 FCSGVLQQLDYALLQCQALVLAPTRELAQQIEKVMRALGDYQGVKVHACVGGTSVREDQRILQAG 157

  Fly   145 QHIVSGTPGRVFDMIKRRVLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATL 209
            .|:|.|||||||||::|:.||...|||.|||||||||::|||:||||:::.|||..||.:.|||:
plant   158 VHVVVGTPGRVFDMLRRQSLRPDCIKMFVLDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATM 222

  Fly   210 PHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNT 274
            |.|.||:|.|||:.|:|||||||||||||||||:|.||:|:||.:||||||:||.|||:|||.||
plant   223 PPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEDWKLETLCDLYETLAITQSVIFVNT 287

  Fly   275 KRKVDWLTEKMREANFTVSSMHGDMPQKERDEIMKEFRAGQSRVLITTDVWARGIDVQQVSLVIN 339
            :|||||||:|||..:.|||:.||||.|..||.||:|||:|.||||||||:.||||||||||||||
plant   288 RRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN 352

  Fly   340 YDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDDIRILRDIEQYYSTQIDEMPMNVADLI 399
            :|||...|.|:|||||||||||||||||||..||.|:|.||:::|:..::|:|.|||||:
plant   353 FDLPTQPENYLHRIGRSGRFGRKGVAINFVTLDDQRMLFDIQKFYNVVVEELPSNVADLL 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7483NP_649788.2 PTZ00424 4..399 CDD:185609 257/383 (67%)
EIF4A-2NP_175829.1 PTZ00424 26..412 CDD:185609 257/383 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53631
OrthoDB 1 1.010 - - D726081at2759
OrthoFinder 1 1.000 - - FOG0000304
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X250
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.