DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7483 and Rs1

DIOPT Version :9

Sequence 1:NP_649788.2 Gene:CG7483 / 40987 FlyBaseID:FBgn0037573 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001286188.1 Gene:Rs1 / 44087 FlyBaseID:FBgn0021995 Length:782 Species:Drosophila melanogaster


Alignment Length:396 Identity:125/396 - (31%)
Similarity:206/396 - (52%) Gaps:24/396 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RKNAQAEDLSN----VEF-ETSEDVEVIPTFNAMNLKEELLRGIYAYGFEKPSAIQQRSITPIVK 62
            :|.|..||..:    ::| :|.|..|.|.:|..|||...|:|.|...|:..|:.||..:|...:.
  Fly   129 KKKAGEEDEEDEGEKMQFADTVEANEQITSFYQMNLSRPLMRAIGVLGYIYPTPIQASTIPVALL 193

  Fly    63 GRDVIAQAQSGTGKTATFSISILQSL------DTTLRETQVLCLSPTRELAVQIQKVILALGDMM 121
            |||:...|.:||||||.:.:..|:.|      :..:  |:||.|.|||||..|:.:|...|....
  Fly   194 GRDICGCAATGTGKTAAYMLPTLERLLYRPLNNKAI--TRVLVLVPTRELGAQVYQVTKQLCQFT 256

  Fly   122 NVQCHVCIGGTNLGEDIRKLDYGQHIVSGTPGRVFDMIKRRVLRT-RAIKMLVLDEADEMLNKGF 185
            .:...:.|||.::......|.....||..||||:.|.||.....| .:|::|:|||||.||::.|
  Fly   257 TIDVGLAIGGLDVKAQEAVLRQNPDIVIATPGRLIDHIKNTPSFTLDSIEVLILDEADRMLDEYF 321

  Fly   186 KEQIYDVYRYLPPATQVVLISATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAV---- 246
            .||:.::........|.:|.|||:..::.::.:..:..||::.|..::.....::|.|:.:    
  Fly   322 AEQMKEIINSCCKTRQTMLFSATMSEQVKDLAAVSLDKPIKVFVNNNQQVAFNLRQEFIRIREDK 386

  Fly   247 --EREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERDEIMK 309
              :||......:|..:.    ...::|..||::...|...:.........:||::.|::|.|.:|
  Fly   387 EGDREPILASLICRTFH----DHCMVFVQTKKQAHRLHILLGLLGVRAGELHGNLTQQQRLESLK 447

  Fly   310 EFRAGQSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDDI 374
            :|:..|..|||.|||.|||:|:..|..|||:.:|...|.||||:||:.|.||.|::::.....:.
  Fly   448 KFKEEQIDVLIATDVAARGLDIVGVKTVINFVMPITTEHYIHRVGRTARAGRAGISVSLAGEKER 512

  Fly   375 RILRDI 380
            :|::||
  Fly   513 KIVKDI 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7483NP_649788.2 PTZ00424 4..399 CDD:185609 125/395 (32%)
Rs1NP_001286188.1 PTZ00424 148..537 CDD:185609 120/377 (32%)
DEADc 159..364 CDD:238167 69/206 (33%)
Helicase_C 393..498 CDD:278689 36/108 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451712
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.