DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7483 and CG9630

DIOPT Version :9

Sequence 1:NP_649788.2 Gene:CG7483 / 40987 FlyBaseID:FBgn0037573 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_649777.1 Gene:CG9630 / 40974 FlyBaseID:FBgn0037561 Length:613 Species:Drosophila melanogaster


Alignment Length:378 Identity:115/378 - (30%)
Similarity:204/378 - (53%) Gaps:31/378 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LKEELLRGIYAYGFEKPSAIQQRSITPIVKGRDVIAQAQSGTGKTATFSISILQSLDTTLRETQ- 96
            |.:.:|:.:.::||::.:.:|..:|..::..:||.|:|.:|:|||..|.:.:|:.|....:||. 
  Fly    14 LSDAVLQVVQSFGFQQMTPVQTAAIPLLLARKDVSAEAVTGSGKTLAFLVPMLEILQRRHKETPW 78

  Fly    97 ------VLCLSPTRELAVQIQKVI---LALGDMMNVQCHVCIGGTNLGEDIRKLDYGQH-IVSGT 151
                  .|.:|||||||.||.:|:   |...|:.::...:.:||.::.|||..|..... |:..|
  Fly    79 GPKEIGALVISPTRELARQISEVLAQFLEHEDLEHLNQQLIVGGNSIEEDIATLRRETPCILVCT 143

  Fly   152 PGRVFDMIKRR------VLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLP 210
            |||:.|:.:|:      ..:.::::.|||||||.:|:.|||..:.::..|||...:..|.|||..
  Fly   144 PGRLEDLFQRKGDDLNLAAQVKSLEFLVLDEADRLLDLGFKTSVNNILGYLPRQRRTGLFSATQT 208

  Fly   211 HEILEMTSKFMTDPIRILVKRDEL--TLEGIKQFFVAVEREEWKFDTLCDLYDT--LTITQAVIF 271
            .|:.::....:.:|:.:.||....  |...::.|:..|| .|.||..|.:...:  ..|.:.::|
  Fly   209 TEVTDLIRAGLRNPVLVSVKEKASVNTPARLQNFYRIVE-PELKFVALLEFLSSPATVIGKVMVF 272

  Fly   272 CNTKRKVDWLTEKMRE--ANFTVSSMHGDMPQKERDEIMKEFRAGQSRVLITTDVWARGIDVQQV 334
            ..|...|::..|.:..  ...||..:||.|..| |..::::||.....||:.|||.|||:||.::
  Fly   273 FPTCACVEYWAEALPPLLPKRTVLGIHGKMKNK-RANVVEKFRNTPQAVLLCTDVLARGLDVPEI 336

  Fly   335 SLVINYDLPNNRELYIHRIGRSGRFGRKGVAINF-VKSDD-----IRILRDIE 381
            ..|:.:|.|:....::||:||:.|.|.:|.|:.| :.|:|     ::|.:.:|
  Fly   337 EWVVQWDPPSTASSFVHRVGRTARQGNEGNALVFLLPSEDAYVHFLKINQKVE 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7483NP_649788.2 PTZ00424 4..399 CDD:185609 115/378 (30%)
CG9630NP_649777.1 DEADc 6..226 CDD:238167 65/211 (31%)
DEXDc 22..232 CDD:214692 65/209 (31%)
HELICc 239..370 CDD:238034 42/132 (32%)
DUF4217 411..470 CDD:290667
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451683
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.