DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7483 and CG7878

DIOPT Version :9

Sequence 1:NP_649788.2 Gene:CG7483 / 40987 FlyBaseID:FBgn0037573 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_649767.1 Gene:CG7878 / 40959 FlyBaseID:FBgn0037549 Length:703 Species:Drosophila melanogaster


Alignment Length:379 Identity:133/379 - (35%)
Similarity:209/379 - (55%) Gaps:32/379 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ELLRGIYAYGFEKPSAIQQRSITPIVKGRDVIAQAQSGTGKTATFSI--SILQSLDTTLRETQ-- 96
            ::|..|...||.|||.||.::...:::|.|:|..||:|||||..|.:  .|.....:|.|.|:  
  Fly   293 DMLEEITKMGFSKPSPIQSQAWPILLQGHDMIGIAQTGTGKTLAFLLPGMIHTEYQSTPRGTRGG 357

  Fly    97 --VLCLSPTRELAVQIQKVILALGDMMNVQCH-------VCI-GGTNLGEDIRKLDYGQHIVSGT 151
              ||.|:||||||:||:         |.|:.:       ||: ||.|....|..|:.|..|:..|
  Fly   358 ANVLVLAPTRELALQIE---------MEVKKYSFRGMKAVCVYGGGNRNMQISDLERGAEIIICT 413

  Fly   152 PGRVFDMIKRRVLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEM 216
            |||:.|:|...|:....|..|||||||.||:.||:.||..|...:.|..|.::.|||.|..:..:
  Fly   414 PGRLNDLIMANVIDVSTITYLVLDEADRMLDMGFEPQIRKVMLDIRPDRQTIMTSATWPPGVRRL 478

  Fly   217 TSKFMTDPIRILV-KRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTIT-QAVIFCNTKRKVD 279
            ...:|.:||::.| ..|......:||....:|.:..||:|:......::.| :.:|||..|.:.|
  Fly   479 AQSYMKNPIQVCVGSLDLAATHSVKQIIKLMEDDMDKFNTITSFVKNMSSTDKIIIFCGRKVRAD 543

  Fly   280 WLTEKMREANFTVSSMHGDMPQKERDEIMKEFRAGQSRVLITTDVWARGIDVQQVSLVINYDLPN 344
            .|:.::....|....:||:..|.:|::.:.:.::|..|:|:.|||.:||:|::.::.|||||.|:
  Fly   544 DLSSELTLDGFMTQCIHGNRDQMDREQAIADIKSGVVRILVATDVASRGLDIEDITHVINYDFPH 608

  Fly   345 NRELYIHRIGRSGRFGRKGVAINFVKSDD-------IRILRDIEQYYSTQIDEM 391
            |.|.|:||:||:||.||:|.:|:|...:|       |.||::.||....::..|
  Fly   609 NIEEYVHRVGRTGRAGRQGTSISFFTREDWAMAKELIEILQEAEQEVPDELHNM 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7483NP_649788.2 PTZ00424 4..399 CDD:185609 133/379 (35%)
CG7878NP_649767.1 KH-I 92..150 CDD:238053
DEADc 288..489 CDD:238167 77/204 (38%)
DEXDc 298..505 CDD:214692 79/215 (37%)
Helicase_C 514..624 CDD:278689 39/109 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451503
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.