DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7483 and Rm62

DIOPT Version :9

Sequence 1:NP_649788.2 Gene:CG7483 / 40987 FlyBaseID:FBgn0037573 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_524243.2 Gene:Rm62 / 40739 FlyBaseID:FBgn0003261 Length:719 Species:Drosophila melanogaster


Alignment Length:391 Identity:133/391 - (34%)
Similarity:206/391 - (52%) Gaps:25/391 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IPTFNAMNLKEELLRGIYAYGFEKPSAIQQRSITPIVKGRDVIAQAQSGTGKTATFSISI----- 84
            |..|:.::|.:.:::.|...|::.|:|||.:.....:.|.:.:..|::|:|||..:.:..     
  Fly   280 IQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHIN 344

  Fly    85 ----LQSLDTTLRETQVLCLSPTRELAVQIQKVILALGDMMNVQCHVCIGGTNLGEDIRKLDYGQ 145
                ||..|..:    .|.|:||||||.|||:|....|....|:.....||...|..:|.|..|.
  Fly   345 NQQPLQRGDGPI----ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGC 405

  Fly   146 HIVSGTPGRVFDMIKRRVLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLP 210
            .||..||||:.|.:.......:....|||||||.||:.||:.||..:...:.|..|.::.|||.|
  Fly   406 EIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWP 470

  Fly   211 HEILEMTSKFMTDPIRILVKRDELTL-EGIKQFFVAVER--EEWKFDT-LCDLYDTL-TITQAVI 270
            .|:.::...|:.:.|:|.:...||:. ..|:|.....:.  :|.|..| |.|:|||. :..:.:|
  Fly   471 KEVKQLAEDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIII 535

  Fly   271 FCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERDEIMKEFRAGQSRVLITTDVWARGIDVQQVS 335
            |..|||:||.|...:|.......::|||..|.|||.:::|||:|:|.:|:.|||.|||:||..:.
  Fly   536 FVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIK 600

  Fly   336 LVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDD-------IRILRDIEQYYSTQIDEMPM 393
            .|||:|.|.|.|.|||||||:||...||.:..|...::       :.:||:..|..:..::.:..
  Fly   601 YVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEINPALENLAR 665

  Fly   394 N 394
            |
  Fly   666 N 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7483NP_649788.2 PTZ00424 4..399 CDD:185609 133/391 (34%)
Rm62NP_524243.2 PTZ00424 280..656 CDD:185609 132/379 (35%)
DEADc 283..488 CDD:238167 66/208 (32%)
HELICc 499..633 CDD:238034 58/133 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451771
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.