DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7483 and eif4a2

DIOPT Version :9

Sequence 1:NP_649788.2 Gene:CG7483 / 40987 FlyBaseID:FBgn0037573 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_998616.2 Gene:eif4a2 / 406760 ZFINID:ZDB-GENE-040426-2802 Length:411 Species:Danio rerio


Alignment Length:378 Identity:273/378 - (72%)
Similarity:319/378 - (84%) Gaps:1/378 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EVIPTFNAMNLKEELLRGIYAYGFEKPSAIQQRSITPIVKGRDVIAQAQSGTGKTATFSISILQS 87
            |:...|:.|||||.|||||||||||||||||||:|.|.:||.||||||||||||||||:|||||.
Zfish    34 EITDNFDDMNLKETLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQ 98

  Fly    88 LDTTLRETQVLCLSPTRELAVQIQKVILALGDMMNVQCHVCIGGTNLGEDIRKLD-YGQHIVSGT 151
            |:...:|||.|.|:||||||.|||||||||||.|...||.||||||:..:::||. ...|||.||
Zfish    99 LEIEQKETQALVLAPTRELAQQIQKVILALGDYMGASCHACIGGTNVRNEMQKLQAEAPHIVVGT 163

  Fly   152 PGRVFDMIKRRVLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEM 216
            |||||||:.||.|..:.|||.|||||||||::|||:|||::::.|....||||:|||:|.::||:
Zfish   164 PGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLSTNIQVVLLSATMPADVLEV 228

  Fly   217 TSKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWL 281
            |:|||.:|:|||||::||||||||||::.|||||||.|||||||:||||||||||.||:||||||
Zfish   229 TTKFMREPVRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWL 293

  Fly   282 TEKMREANFTVSSMHGDMPQKERDEIMKEFRAGQSRVLITTDVWARGIDVQQVSLVINYDLPNNR 346
            ||||...:||||::||||.|||||.||:|||:|.||||||||:.||||||||||||||||||.||
Zfish   294 TEKMHARDFTVSALHGDMDQKERDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNR 358

  Fly   347 ELYIHRIGRSGRFGRKGVAINFVKSDDIRILRDIEQYYSTQIDEMPMNVADLI 399
            |.|||||||.|||||||||||||..:|.|||||||.:|:|.::||||||||||
Zfish   359 ENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7483NP_649788.2 PTZ00424 4..399 CDD:185609 271/376 (72%)
eif4a2NP_998616.2 PTZ00424 25..411 CDD:185609 271/376 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53631
OrthoDB 1 1.010 - - D321438at33208
OrthoFinder 1 1.000 - - FOG0000304
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X250
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.