DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7483 and abs

DIOPT Version :9

Sequence 1:NP_649788.2 Gene:CG7483 / 40987 FlyBaseID:FBgn0037573 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_524220.1 Gene:abs / 40530 FlyBaseID:FBgn0015331 Length:619 Species:Drosophila melanogaster


Alignment Length:396 Identity:122/396 - (30%)
Similarity:199/396 - (50%) Gaps:23/396 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VEFETSEDVEVIPTFNAMNLKEELLRGIYAYGFEKPSAIQQRSITPIVKGRDVIAQAQSGTGKTA 78
            ||.||..  ..|.:|..|...:.:|.|:.|.|.:.|:.||.:.:..::.|||:|..|.:|:|||.
  Fly   167 VEGETPS--PPIRSFREMKFPKGILNGLAAKGIKNPTPIQVQGLPTVLAGRDLIGIAFTGSGKTL 229

  Fly    79 TFSISILQ-------SLDTTLRETQV-LCLSPTRELAVQIQKVI------LALGDMMNVQCHVCI 129
            .|.:.::.       ||.....|... |.:.|:||||.|..::|      |....|..::..:.:
  Fly   230 VFVLPVIMFALEQEYSLPFERNEGPYGLIICPSRELAKQTHEIIQHYSKHLQACGMPEIRSCLAM 294

  Fly   130 GGTNLGEDIRKLDYGQHIVSGTPGRVFDMIKRRVLRTRAIKMLVLDEADEMLNKGFKEQIYDVYR 194
            ||..:.|.:..:..|.|||..||||:.||:.:::|.....:.|.:||||.|::.||:|.:..::.
  Fly   295 GGLPVSEALDVISRGVHIVVATPGRLMDMLDKKILTLDMCRYLCMDEADRMIDMGFEEDVRTIFS 359

  Fly   195 YLPPATQVVLISATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDL 259
            :.....|.:|.|||:|.:|.......:..|:.|.|.|.......:.|....|::|.    .:..|
  Fly   360 FFKGQRQTLLFSATMPKKIQNFARSALVKPVTINVGRAGAASMNVTQQVEYVKQEA----KVVYL 420

  Fly   260 YDTL--TITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERDEIMKEFRAGQSRVLITT 322
            .|.|  |....:||...|:.||.:.|.:........::||...|:||...:..:|.|:..||:.|
  Fly   421 LDCLQKTAPPVLIFAEKKQDVDCIHEYLLLKGVEAVAIHGGKDQEERSRAVDAYRVGKKDVLVAT 485

  Fly   323 DVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFV-KSDDIRILRDIEQYYST 386
            ||.::|:|...|..|||||:|::.|.|:|||||:||...||:|...: |:.:..:|.|::.....
  Fly   486 DVASKGLDFPNVQHVINYDMPDDIENYVHRIGRTGRSNTKGLATTLINKTTEQSVLLDLKHLLIE 550

  Fly   387 QIDEMP 392
            ...|:|
  Fly   551 GKQEVP 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7483NP_649788.2 PTZ00424 4..399 CDD:185609 122/396 (31%)
absNP_524220.1 DEADc 179..393 CDD:238167 63/213 (30%)
DEXDc 192..397 CDD:214692 61/204 (30%)
Helicase_C 414..523 CDD:278689 41/112 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451779
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.