DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7483 and CG6418

DIOPT Version :9

Sequence 1:NP_649788.2 Gene:CG7483 / 40987 FlyBaseID:FBgn0037573 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_648413.1 Gene:CG6418 / 39218 FlyBaseID:FBgn0036104 Length:791 Species:Drosophila melanogaster


Alignment Length:388 Identity:115/388 - (29%)
Similarity:197/388 - (50%) Gaps:25/388 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IPTFNAMNLKEELLRGIYAYGFEKPSAIQQRSITPIVKGRDVIAQAQSGTGKTATFSISILQSLD 89
            :.:|......|:|::.:....:.:|:.||.:::...:.|||:|..|::|:||||.|   |...|.
  Fly   268 VTSFGHFGFDEQLIKAVRKAEYTQPTPIQAQAVPTALSGRDIIGIAKTGSGKTAAF---IWPMLM 329

  Fly    90 TTLRETQV--------LCLSPTRELAVQIQKVILALGDMMNVQCHVCIGGTNLGEDIRKLDYGQH 146
            ..:.:.|:        |.|:|||||::||.......|.:.|:....|.||.:..|..:.|:.|..
  Fly   330 HVMDQKQLKPGDGPIGLILAPTRELSLQIYNEAKKFGKVYNLNVVCCYGGGSKWEQSKALEQGAE 394

  Fly   147 IVSGTPGRVFDMIKRRVLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPH 211
            |:..||||:.||:|.:....|.:..|||||||.|.:.||:.|:..:..::.|..|.::.|||...
  Fly   395 IIVATPGRMIDMVKMKATNLRRVTFLVLDEADRMFHMGFEPQVRSICNHVRPDRQCLMFSATFKK 459

  Fly   212 EILEMTSKFMTDPIRI----LVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFC 272
            .|..:....::||:||    |.:.::...:.:..|...:::..|   .||.|...|:....:||.
  Fly   460 RIERLARDVLSDPVRIVQGDLNEANQDITQSVYVFPNPLQKWNW---LLCHLVKFLSEGSVLIFV 521

  Fly   273 NTKRKVDWLTEKMREANFTVSSMHGDMPQKERDEIMKEFRAGQSRVLITTDVWARGIDVQQVSLV 337
            ..|...:.::..:....:....:||||.|.:|::::.:|:..:..:|:.|||.|||:|:..:..|
  Fly   522 TKKVDAETVSNNLLIKEYNCLLLHGDMDQADRNKVITQFKRKECDILVATDVAARGLDIPHIRNV 586

  Fly   338 INYDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDD-------IRILRDIEQYYSTQIDEMPM 393
            :|||...:.|.:.|||||:||.|.||.|...|...|       :|.|...:|.....:.|:.|
  Fly   587 VNYDTARDIETHTHRIGRTGRAGEKGNAYTLVTDKDKEFAGHLVRNLEGADQLVPDDLMELAM 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7483NP_649788.2 PTZ00424 4..399 CDD:185609 115/388 (30%)
CG6418NP_648413.1 DEADc 271..475 CDD:238167 65/206 (32%)
DEXDc 284..489 CDD:214692 65/207 (31%)
Helicase_C 504..609 CDD:278689 34/104 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451737
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.