DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7483 and CG10333

DIOPT Version :9

Sequence 1:NP_649788.2 Gene:CG7483 / 40987 FlyBaseID:FBgn0037573 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_609888.2 Gene:CG10333 / 35112 FlyBaseID:FBgn0032690 Length:822 Species:Drosophila melanogaster


Alignment Length:407 Identity:123/407 - (30%)
Similarity:203/407 - (49%) Gaps:35/407 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NVEFETSEDVEVIPTFNAMNLKEELLRGIYAYGFEKPSAIQQRSITPIVKGRDVIAQAQSGTGKT 77
            ||..:.......|.::|.....:|::..|...|:::|:.||:::|...::.||:|..|::|:|||
  Fly   381 NVTIKGGRIPNPIRSWNESGFPKEIIDIIDKVGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKT 445

  Fly    78 ATFSISIL---QSLDTTLRETQV------LCLSPTRELAVQIQKVILALGDMMNVQCHVCIGGTN 133
            ..|.|.:|   |||....|...|      :.::||||||.||::.....|..:.::..|.:||.:
  Fly   446 LAFLIPLLSWIQSLPKIERLEDVDQGPYAIIMAPTRELAQQIEEETTKFGQPLGIRTVVVVGGLS 510

  Fly   134 LGEDIRKLDYGQHIVSGTPGRVFDMIKRRVLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLP- 197
            ..|...:|..|..||..||||:.|:::.|.|.......:||||||.|::.||:..:..:..|:| 
  Fly   511 REEQGFRLRLGCEIVIATPGRLIDVLENRYLVLNQCTYIVLDEADRMIDMGFEPDVQKILEYMPV 575

  Fly   198 ----PAT--------------------QVVLISATLPHEILEMTSKFMTDPIRILVKRDELTLEG 238
                |.|                    |.|:.:||:|..:..:...::..|..:.:.......|.
  Fly   576 TNLKPDTEEAEDETKLMENFYTKKKYRQTVMFTATMPPAVERLARTYLRRPATVYIGSVGKPTER 640

  Fly   239 IKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKE 303
            .:| .|.:..|..|...|.::.........:||.|.|:..|.|.:.:.:..:...::||...|::
  Fly   641 TEQ-IVYMMGENDKRKKLMEILSRKIDPPVIIFVNQKKGADVLAKGLEKLGYNSCTLHGGKGQEQ 704

  Fly   304 RDEIMKEFRAGQSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINF 368
            |:..:...::|...:|:.|||..||||::.||||||||:....|.|.|||||:||.|:.|.||:|
  Fly   705 REYALAALKSGAKDILVATDVAGRGIDIKDVSLVINYDMAKTIEDYTHRIGRTGRAGKTGCAISF 769

  Fly   369 VKSDDIRILRDIEQYYS 385
            |..||..:..|::|..|
  Fly   770 VTKDDSALFYDLKQCVS 786

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7483NP_649788.2 PTZ00424 4..399 CDD:185609 123/407 (30%)
CG10333NP_609888.2 DEADc 396..629 CDD:238167 67/232 (29%)
DEXDc 409..632 CDD:214692 65/222 (29%)
Helicase_C 651..761 CDD:278689 38/109 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451800
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.