DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7483 and CG32344

DIOPT Version :9

Sequence 1:NP_649788.2 Gene:CG7483 / 40987 FlyBaseID:FBgn0037573 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_612028.4 Gene:CG32344 / 326208 FlyBaseID:FBgn0052344 Length:827 Species:Drosophila melanogaster


Alignment Length:383 Identity:121/383 - (31%)
Similarity:196/383 - (51%) Gaps:28/383 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FNAMNLKEELLRGIYAYGFEKPSAIQQRSITPIVKGRDVIAQAQSGTGKTATFSISILQSLDTTL 92
            |.:|.|..||::||...|::.|:.||:::|..|::||||:|.|::|:||||.|.|.:.:.|..  
  Fly    41 FQSMGLGFELIKGITKRGYKVPTPIQRKTIPLILEGRDVVAMAKTGSGKTACFLIPLFEKLQR-- 103

  Fly    93 RE----TQVLCLSPTRELAVQIQKVILALGDMMNVQCHVCIGGTNLGEDIRKLDYGQHIVSGTPG 153
            ||    .:.|.||||||||||..|.|..||..|.::..:.:||.::......:.....::..|||
  Fly   104 REPTKGARALILSPTRELAVQTYKFIKELGRFMELKSILVLGGDSMDSQFSAIHTCPDVIVATPG 168

  Fly   154 RVFDMIKRRVLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTS 218
            |...:.....|:..:|:.:|.||||.:...||.||:.:....||.:.|.|:.|||||..::|...
  Fly   169 RFLHLCVEMDLKLNSIEYVVFDEADRLFEMGFGEQLNETLHRLPSSRQTVMFSATLPKLLVEFAR 233

  Fly   219 KFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTI---------TQAVIFCNT 274
            ..:.||:.|.:..:....:.:...|:....:        |.|..|.:         :|.|:|..|
  Fly   234 AGLNDPVLIRLDVESKLPDALALKFLYCRPD--------DRYTALVVLLKYVIPVQSQTVVFAGT 290

  Fly   275 KRKVDWLTEKMREANFTVSSMHGDMPQKERDEIMKEFRAGQSRVLITTDVWARGIDVQQVSLVIN 339
            :..|:.::..:.||..:.:|::..:....|.....:|...:..|||.|||.|||||:..:..|:|
  Fly   291 QHHVELISYILTEAGISNASVYSSLDPAARKINTAKFVNKKVSVLIVTDVAARGIDIPSLDFVVN 355

  Fly   340 YDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDDIRILRDIEQYYSTQIDEMPMNVAD 397
            ...|...:|::||:||..|.||.|.|.:.|.:||...|.|:..:.:     .|.|:.|
  Fly   356 LHFPGKPKLFVHRVGRCARAGRTGTAYSIVSTDDTAHLLDLHLFLN-----RPFNIHD 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7483NP_649788.2 PTZ00424 4..399 CDD:185609 121/383 (32%)
CG32344NP_612028.4 DEADc 41..243 CDD:238167 74/203 (36%)
DEXDc 54..243 CDD:214692 68/190 (36%)
HELICc 263..384 CDD:238034 37/128 (29%)
DBP10CT 666..721 CDD:285373
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451650
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.