DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7483 and Eif4a1

DIOPT Version :9

Sequence 1:NP_649788.2 Gene:CG7483 / 40987 FlyBaseID:FBgn0037573 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_006246686.1 Gene:Eif4a1 / 287436 RGDID:735141 Length:411 Species:Rattus norvegicus


Alignment Length:378 Identity:270/378 - (71%)
Similarity:318/378 - (84%) Gaps:1/378 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EVIPTFNAMNLKEELLRGIYAYGFEKPSAIQQRSITPIVKGRDVIAQAQSGTGKTATFSISILQS 87
            |::.:|:.|||.|.|||||||||||||||||||:|.|.:||.||||||||||||||||:|||||.
  Rat    34 EIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQ 98

  Fly    88 LDTTLRETQVLCLSPTRELAVQIQKVILALGDMMNVQCHVCIGGTNLGEDIRKLDY-GQHIVSGT 151
            ::..|:.||.|.|:||||||.|||||::||||.|...||.||||||:..:::||.. ..||:.||
  Rat    99 IELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGT 163

  Fly   152 PGRVFDMIKRRVLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEM 216
            |||||||:.||.|..:.|||.|||||||||::|||:||||:::.|...|||||:|||:|.::||:
  Rat   164 PGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEV 228

  Fly   217 TSKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWL 281
            |.|||.||||||||::|||||||:||::.|||||||.|||||||:||||||||||.||:||||||
  Rat   229 TKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWL 293

  Fly   282 TEKMREANFTVSSMHGDMPQKERDEIMKEFRAGQSRVLITTDVWARGIDVQQVSLVINYDLPNNR 346
            ||||...:||||:|||||.|||||.||:|||:|.||||||||:.||||||||||||||||||.||
  Rat   294 TEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNR 358

  Fly   347 ELYIHRIGRSGRFGRKGVAINFVKSDDIRILRDIEQYYSTQIDEMPMNVADLI 399
            |.|||||||.|||||||||||.|..:|.|.|||||.:|:|.|:|||:||||||
  Rat   359 ENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7483NP_649788.2 PTZ00424 4..399 CDD:185609 268/376 (71%)
Eif4a1XP_006246686.1 PTZ00424 25..411 CDD:185609 268/376 (71%)
DEADc 39..240 CDD:238167 133/200 (67%)
HELICc 251..366 CDD:238034 92/114 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53631
OrthoDB 1 1.010 - - D321438at33208
OrthoFinder 1 1.000 - - FOG0000304
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X250
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.