DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7483 and EIF4A1

DIOPT Version :9

Sequence 1:NP_649788.2 Gene:CG7483 / 40987 FlyBaseID:FBgn0037573 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001407.1 Gene:EIF4A1 / 1973 HGNCID:3282 Length:406 Species:Homo sapiens


Alignment Length:378 Identity:270/378 - (71%)
Similarity:318/378 - (84%) Gaps:1/378 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EVIPTFNAMNLKEELLRGIYAYGFEKPSAIQQRSITPIVKGRDVIAQAQSGTGKTATFSISILQS 87
            |::.:|:.|||.|.|||||||||||||||||||:|.|.:||.||||||||||||||||:|||||.
Human    29 EIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQ 93

  Fly    88 LDTTLRETQVLCLSPTRELAVQIQKVILALGDMMNVQCHVCIGGTNLGEDIRKLDY-GQHIVSGT 151
            ::..|:.||.|.|:||||||.|||||::||||.|...||.||||||:..:::||.. ..||:.||
Human    94 IELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGT 158

  Fly   152 PGRVFDMIKRRVLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEM 216
            |||||||:.||.|..:.|||.|||||||||::|||:||||:::.|...|||||:|||:|.::||:
Human   159 PGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEV 223

  Fly   217 TSKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWL 281
            |.|||.||||||||::|||||||:||::.|||||||.|||||||:||||||||||.||:||||||
Human   224 TKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWL 288

  Fly   282 TEKMREANFTVSSMHGDMPQKERDEIMKEFRAGQSRVLITTDVWARGIDVQQVSLVINYDLPNNR 346
            ||||...:||||:|||||.|||||.||:|||:|.||||||||:.||||||||||||||||||.||
Human   289 TEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNR 353

  Fly   347 ELYIHRIGRSGRFGRKGVAINFVKSDDIRILRDIEQYYSTQIDEMPMNVADLI 399
            |.|||||||.|||||||||||.|..:|.|.|||||.:|:|.|:|||:||||||
Human   354 ENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7483NP_649788.2 PTZ00424 4..399 CDD:185609 268/376 (71%)
EIF4A1NP_001407.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PTZ00424 20..406 CDD:185609 268/376 (71%)
Q motif 32..60 21/27 (78%)
DEAD box 182..185 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53631
OrthoDB 1 1.010 - - D321438at33208
OrthoFinder 1 1.000 - - FOG0000304
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X250
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.