DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11698 and CG14840

DIOPT Version :9

Sequence 1:NP_649787.2 Gene:CG11698 / 40986 FlyBaseID:FBgn0037572 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_650349.1 Gene:CG14840 / 41734 FlyBaseID:FBgn0038217 Length:300 Species:Drosophila melanogaster


Alignment Length:202 Identity:74/202 - (36%)
Similarity:119/202 - (58%) Gaps:11/202 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RNDPRFKPGSLPCKTSMKASQVASKAAKDAKDAKDAQPCAAEMAGYRAREMLADRALQAAKAAEA 97
            |.||:           .|||.:|.|||::||.|.|:|..|||.|..:.:..||.:|.|:|:||||
  Fly    81 RGDPK-----------QKASNIAQKAAQEAKAASDSQMAAAEAAASQVKNELAAKAAQSARAAEA 134

  Fly    98 ALNGKKQLLDEYTKSLAETNRVIEEIQRAIAASSCSATSAKGIRDKLCTSVNIMKSMLKEMGGNL 162
            ||.||:|::::..:.:.|.:.|:.|:..::..:..:|.:|.....:..:.:|.:|:::.....||
  Fly   135 ALAGKQQIVEQLQQEMTEADAVVTEVTSSLQNTQANANAAASAAHEAQSQLNQLKNLVIAATSNL 199

  Fly   163 DNIRRMADSAQKEALEKRSLLKAARMRVEELHSCMCEAQKDLERNKQSAKKANDAAKEAQQRIEA 227
            .||..:|..||:|..||..||:||:.|||.|...|.||:.|.|:.||:|.||..||.||:|:.:.
  Fly   200 ANIENVASGAQQELAEKTQLLEAAKHRVENLTRQMTEAKTDFEKTKQAAYKAACAAVEAKQKAQR 264

  Fly   228 LQKLVSR 234
            .:::..|
  Fly   265 SRRMTHR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11698NP_649787.2 DUF745 45..225 CDD:283087 70/179 (39%)
CG14840NP_650349.1 DUF745 82..262 CDD:283087 72/190 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007622
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.