DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11694 and CG14354

DIOPT Version :9

Sequence 1:NP_649786.1 Gene:CG11694 / 40985 FlyBaseID:FBgn0037571 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_651433.1 Gene:CG14354 / 43120 FlyBaseID:FBgn0039376 Length:298 Species:Drosophila melanogaster


Alignment Length:237 Identity:118/237 - (49%)
Similarity:153/237 - (64%) Gaps:5/237 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 HSAGHKLPQSSNEIAALMSDHHGDGDNSVSSSSG--GAPCDFKM---NGKTRVKASCIAQKAAKE 76
            |...:.|...|:.:||....|.....|...|.|.  ....|..|   .|.::..||.||||||:|
  Fly    11 HILLYHLLMISSSLAACYQRHSSCPQNQQQSRSQLLDQSADLTMGIRQGNSKQTASNIAQKAAQE 75

  Fly    77 AMEASDAQIEAGEAAARQVKQQLADKALAAAKAAEAALAGKQQIVEQLESEVREGELVVQEESTL 141
            |.:|||.|..|..|||||||.|||:||:|||||||||||||||::|||:.||.|.|::||||:..
  Fly    76 AKKASDTQAPAALAAARQVKHQLAEKAIAAAKAAEAALAGKQQLMEQLQDEVHEAEIIVQEETYS 140

  Fly   142 LQTTQTTYAAAGQAAKQAADQLNTITLAVKNAQDNVVNSEHVASGAQQELGEKQQLVEAAKKRVE 206
            |..:||....|...|||....|.::..:||.|::.|.|:|..||||||||.||.||||.|::|.|
  Fly   141 LVGSQTNVNVAVATAKQCQTLLQSLRSSVKVAEEAVSNAEAAASGAQQELCEKNQLVETARQRAE 205

  Fly   207 LLLRQLEVARVDFKNTKNAAEKAACAAQEARHRATRERRRAE 248
            :|::||..|::|:.||:.||.:|||||.|||::|.|:||..|
  Fly   206 MLMQQLRSAKLDYTNTRKAAYRAACAANEARNKAVRDRRSYE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11694NP_649786.1 Ribosomal_S11 34..>95 CDD:294237 26/65 (40%)
DUF745 60..223 CDD:283087 91/162 (56%)
CG14354NP_651433.1 DUF745 59..239 CDD:283087 102/179 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453483
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27396
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007622
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.