DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11693 and CG14841

DIOPT Version :9

Sequence 1:NP_001246985.1 Gene:CG11693 / 40984 FlyBaseID:FBgn0037570 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_650350.1 Gene:CG14841 / 41735 FlyBaseID:FBgn0038218 Length:274 Species:Drosophila melanogaster


Alignment Length:214 Identity:66/214 - (30%)
Similarity:102/214 - (47%) Gaps:1/214 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 FEPA-KVKLSHFEGSSDYIVHSHRGGGGGGSGGYLADNGLRSIAKGSADQALSAVASQNAAGKQA 139
            :||| :.|.:...|||:....|.......|.....|.:...|||..:|..|.:|..:|.|||:.|
  Fly    47 YEPASEKKQTASGGSSEGCETSSAVQNSCGLSQKNAKSKASSIAIKAAQDAKAANDAQMAAGEAA 111

  Fly   140 SYVAKSTLAQAAAQAAGTAVAVLKGKEVLLHRLEDQSVEAHKAMENELTQLQQAKRSAKAAQYAA 204
            |...|..||:.|.|||..|.|.|.||:.::.:||.:..||...::.....|...:.:|::|..|.
  Fly   112 SLQVKQDLAEKAVQAARAAEAALAGKQQIMEQLELEEKEAVAVVDEVKNSLHSTQVNAESAMLAF 176

  Fly   205 QQAINHVSVLTAALNNAQSASELAQKAASEAAAELASQIDMVAQAKTKLEHAESQAYAARLDYEE 269
            .:|...:..|...|..|.:.....:..|:.|..|:..:..::..|..::|....|..|||.||::
  Fly   177 SEAKIQLDQLKVLLAEATAQMTNIETFANGAQLEMDEKGQLLEAANRRVESISRQVVAARQDYDK 241

  Fly   270 TRDAAEKATLSAQEAHLNA 288
            |:.||.||..:|.||...|
  Fly   242 TKKAAYKAACAAVEAKQKA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11693NP_001246985.1 DUF745 108..288 CDD:283087 56/179 (31%)
CG14841NP_650350.1 DUF745 81..260 CDD:283087 56/178 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.