DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11693 and CG14840

DIOPT Version :9

Sequence 1:NP_001246985.1 Gene:CG11693 / 40984 FlyBaseID:FBgn0037570 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_650349.1 Gene:CG14840 / 41734 FlyBaseID:FBgn0038217 Length:300 Species:Drosophila melanogaster


Alignment Length:314 Identity:89/314 - (28%)
Similarity:130/314 - (41%) Gaps:78/314 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSLLHLLLLALFLVAMPTQGRKIKRKEPHYHHHVNVPPPPPPPSPHGPGPVPQQTAVIEHEVPP 65
            ||....|||:.|.|.|.|       |.| .||:.                  |.:|         
  Fly     1 MPGTKALLLVLLLLRAFP-------RLE-SYHYR------------------PAET--------- 30

  Fly    66 YTYEAINHDEFEPAKVKLSHFEGSSDYIVHSHRGGGGGGSGGYLADNGLR--------------- 115
                   :|     |..||...|.:........||.||||.|....|..:               
  Fly    31 -------ND-----KQCLSALYGDASIDGTGGAGGLGGGSEGCGEPNSKKGVGCSSGTGVFGRGD 83

  Fly   116 ------SIAKGSADQALSAVASQNAAGKQASYVAKSTLAQAAAQAAGTAVAVLKGKEVLLHRLED 174
                  :||:.:|.:|.:|..||.||.:.|:...|:.||..|||:|..|.|.|.||:.::.:|:.
  Fly    84 PKQKASNIAQKAAQEAKAASDSQMAAAEAAASQVKNELAAKAAQSARAAEAALAGKQQIVEQLQQ 148

  Fly   175 QSVEAHKAMENELTQLQQAKRSAKAAQYAAQQA---INHVSVLTAALNNAQSASELA--QKAASE 234
            :..||...:....:.||..:.:|.||..||.:|   :|.:..|..|     :.|.||  :..||.
  Fly   149 EMTEADAVVTEVTSSLQNTQANANAAASAAHEAQSQLNQLKNLVIA-----ATSNLANIENVASG 208

  Fly   235 AAAELASQIDMVAQAKTKLEHAESQAYAARLDYEETRDAAEKATLSAQEAHLNA 288
            |..|||.:..::..||.::|:...|...|:.|:|:|:.||.||..:|.||...|
  Fly   209 AQQELAEKTQLLEAAKHRVENLTRQMTEAKTDFEKTKQAAYKAACAAVEAKQKA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11693NP_001246985.1 DUF745 108..288 CDD:283087 61/205 (30%)
CG14840NP_650349.1 DUF745 82..262 CDD:283087 60/184 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.