DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11693 and CG11698

DIOPT Version :9

Sequence 1:NP_001246985.1 Gene:CG11693 / 40984 FlyBaseID:FBgn0037570 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_649787.2 Gene:CG11698 / 40986 FlyBaseID:FBgn0037572 Length:262 Species:Drosophila melanogaster


Alignment Length:282 Identity:59/282 - (20%)
Similarity:104/282 - (36%) Gaps:72/282 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLLHLLLLALFLVAMPTQGRKIKRKEPHYHHHVNVPPPPPPPSPHGPGPVPQQTAVIEHEVPPYT 67
            ||:.:|||:..|::  |.....:|.:|.:.                ||.:|.:|:          
  Fly    12 SLVTMLLLSNILLS--TAAHPAQRNDPRFK----------------PGSLPCKTS---------- 48

  Fly    68 YEAINHDEFEPAKVKLSHFEGSSDYIVHSHRGGGGGGSGGYLADNGLRSIAKGSADQALSAVASQ 132
                         :|.|                               .:|..:|..|..|..:|
  Fly    49 -------------MKAS-------------------------------QVASKAAKDAKDAKDAQ 69

  Fly   133 NAAGKQASYVAKSTLAQAAAQAAGTAVAVLKGKEVLLHRLEDQSVEAHKAMENELTQLQQAKRSA 197
            ..|.:.|.|.|:..||..|.|||..|.|.|.||:.||........|.::.:|.....:..:..||
  Fly    70 PCAAEMAGYRAREMLADRALQAAKAAEAALNGKKQLLDEYTKSLAETNRVIEEIQRAIAASSCSA 134

  Fly   198 KAAQYAAQQAINHVSVLTAALNNAQSASELAQKAASEAAAELASQIDMVAQAKTKLEHAESQAYA 262
            .:|:....:....|:::.:.|.......:..::.|..|..|...:..::..|:.::|...|....
  Fly   135 TSAKGIRDKLCTSVNIMKSMLKEMGGNLDNIRRMADSAQKEALEKRSLLKAARMRVEELHSCMCE 199

  Fly   263 ARLDYEETRDAAEKATLSAQEA 284
            |:.|.|..:.:|:||..:|:||
  Fly   200 AQKDLERNKQSAKKANDAAKEA 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11693NP_001246985.1 DUF745 108..288 CDD:283087 44/177 (25%)
CG11698NP_649787.2 DUF745 45..225 CDD:283087 47/231 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.