DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11693 and CG11694

DIOPT Version :9

Sequence 1:NP_001246985.1 Gene:CG11693 / 40984 FlyBaseID:FBgn0037570 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_649786.1 Gene:CG11694 / 40985 FlyBaseID:FBgn0037571 Length:261 Species:Drosophila melanogaster


Alignment Length:208 Identity:71/208 - (34%)
Similarity:107/208 - (51%) Gaps:12/208 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 IVHSHRGGG----GGGSGGYLAD---NG-----LRSIAKGSADQALSAVASQNAAGKQASYVAKS 145
            ::..|.|.|    ...|||...|   ||     ...||:.:|.:|:.|..:|..||:.|:...|.
  Fly    33 LMSDHHGDGDNSVSSSSGGAPCDFKMNGKTRVKASCIAQKAAKEAMEASDAQIEAGEAAARQVKQ 97

  Fly   146 TLAQAAAQAAGTAVAVLKGKEVLLHRLEDQSVEAHKAMENELTQLQQAKRSAKAAQYAAQQAINH 210
            .||..|..||..|.|.|.||:.::.:||.:..|....::.|.|.||..:.:..||..||:||.:.
  Fly    98 QLADKALAAAKAAEAALAGKQQIVEQLESEVREGELVVQEESTLLQTTQTTYAAAGQAAKQAADQ 162

  Fly   211 VSVLTAALNNAQSASELAQKAASEAAAELASQIDMVAQAKTKLEHAESQAYAARLDYEETRDAAE 275
            ::.:|.|:.|||.....::..||.|..||..:..:|..||.::|....|...||:|::.|::|||
  Fly   163 LNTITLAVKNAQDNVVNSEHVASGAQQELGEKQQLVEAAKKRVELLLRQLEVARVDFKNTKNAAE 227

  Fly   276 KATLSAQEAHLNA 288
            ||..:||||...|
  Fly   228 KAACAAQEARHRA 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11693NP_001246985.1 DUF745 108..288 CDD:283087 64/187 (34%)
CG11694NP_649786.1 Ribosomal_S11 34..>95 CDD:294237 18/60 (30%)
DUF745 60..223 CDD:283087 52/162 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.