DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgt1 and SGT1

DIOPT Version :9

Sequence 1:NP_649783.2 Gene:Sgt1 / 40982 FlyBaseID:FBgn0265101 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_014700.1 Gene:SGT1 / 854222 SGDID:S000005583 Length:395 Species:Saccharomyces cerevisiae


Alignment Length:208 Identity:67/208 - (32%)
Similarity:103/208 - (49%) Gaps:37/208 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DWYQSETKVVITVLLKNAVDKNYAVEI-----------TQKRVHMTADGYELDLKLLHPIVVERS 59
            |||||.|.|.|::...|..:....|.|           ...:|..:...::.:.||.|.:..:..
Yeast   188 DWYQSSTSVTISLFTVNLPESKEQVNIYISPNDRRTLSISYQVPKSGSEFQYNAKLSHEVDPKAV 252

  Fly    60 SYKAFSTKVEITLAKETGIRWENLEEAIV--AAPVKPKAKNWD---QLVSEE------------- 106
            |.|.|..|:||||:|....:|:.|||.|:  ::.:..:.||.|   :|:|.|             
Yeast   253 SLKIFPKKLEITLSKIDSTQWKKLEEDILTESSRLSDEGKNSDSATRLLSAETASKERLSYPSSS 317

  Fly   107 -EKID------EKEAKGEA-ALTNLFKKIYSSSSPEVQKAMNKSFSESGGTVLSTNWNEVGKERV 163
             :|||      ::||..|| :..:.|:|:|:.:.|:.::||.|||.||.||.|||:|.:|.|..|
Yeast   318 KKKIDWSKLDIDEEADEEAGSADSFFQKLYAGADPDTKRAMMKSFIESNGTALSTDWEDVSKGTV 382

  Fly   164 TVKPPNGTEFREW 176
            ...||.|.|.:.|
Yeast   383 KTSPPEGMEPKHW 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sgt1NP_649783.2 p23_CS_SGT1_like 6..84 CDD:107223 25/88 (28%)
SGS 97..176 CDD:282811 37/102 (36%)
SGT1NP_014700.1 SGT1 10..395 CDD:227422 66/206 (32%)
TPR repeat 37..77 CDD:276809
TPR repeat 82..114 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I2444
eggNOG 1 0.900 - - E1_COG5091
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I1503
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004070
OrthoInspector 1 1.000 - - oto99038
orthoMCL 1 0.900 - - OOG6_102530
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R491
SonicParanoid 1 1.000 - - X2822
TreeFam 1 0.960 - -
1110.750

Return to query results.
Submit another query.