DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgt1 and SGT1A

DIOPT Version :9

Sequence 1:NP_649783.2 Gene:Sgt1 / 40982 FlyBaseID:FBgn0265101 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001031704.1 Gene:SGT1A / 828457 AraportID:AT4G23570 Length:351 Species:Arabidopsis thaliana


Alignment Length:198 Identity:72/198 - (36%)
Similarity:112/198 - (56%) Gaps:25/198 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RHDWYQSETKVVITVLLKNAVDKNYAVEITQKRVHMT-----ADGYELDLKLLHPIVVERSSYKA 63
            ||::||...:||:||..|....:|..::..::.:.:.     .|.|.|..:|...|:.::..|:.
plant   154 RHEYYQKPEEVVVTVFAKGIPKQNVNIDFGEQILSVVIEVPGEDAYYLQPRLFGKIIPDKCKYEV 218

  Fly    64 FSTKVEITLAKETGIRWENLEE----AIV-------------AAPVKPKAKNWDQLVSEEEKIDE 111
            .|||:||.|||...|.|.:||.    |::             |.|...|.|:||:|.:|.:| .|
plant   219 LSTKIEICLAKADIITWASLEHGKGPAVLPKPNVSSEVSQRPAYPSSKKVKDWDKLEAEVKK-QE 282

  Fly   112 KEAK--GEAALTNLFKKIYSSSSPEVQKAMNKSFSESGGTVLSTNWNEVGKERVTVKPPNGTEFR 174
            |:.|  |:|||...|::||.::..::::||:|||.||.||||||||.|||.:.:...||:|.|.:
plant   283 KDEKLEGDAALNKFFREIYQNADEDMRRAMSKSFVESNGTVLSTNWQEVGTKTIESTPPDGMELK 347

  Fly   175 EWE 177
            :||
plant   348 KWE 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sgt1NP_649783.2 p23_CS_SGT1_like 6..84 CDD:107223 24/82 (29%)
SGS 97..176 CDD:282811 38/80 (48%)
SGT1ANP_001031704.1 PLN03088 1..351 CDD:215568 72/198 (36%)
TPR repeat 35..66 CDD:276809
TPR repeat 71..96 CDD:276809
p23_CS_SGT1_like 156..239 CDD:107223 24/82 (29%)
SGS 269..349 CDD:282811 38/80 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 88 1.000 Domainoid score I2718
eggNOG 1 0.900 - - E1_COG5091
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4877
Inparanoid 1 1.050 132 1.000 Inparanoid score I1865
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426397at2759
OrthoFinder 1 1.000 - - FOG0004070
OrthoInspector 1 1.000 - - otm3211
orthoMCL 1 0.900 - - OOG6_102530
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2822
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.730

Return to query results.
Submit another query.