DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgt1 and SGT1A

DIOPT Version :10

Sequence 1:NP_649783.2 Gene:Sgt1 / 40982 FlyBaseID:FBgn0265101 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001031704.1 Gene:SGT1A / 828457 AraportID:AT4G23570 Length:351 Species:Arabidopsis thaliana


Alignment Length:198 Identity:72/198 - (36%)
Similarity:112/198 - (56%) Gaps:25/198 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RHDWYQSETKVVITVLLKNAVDKNYAVEITQKRVHMT-----ADGYELDLKLLHPIVVERSSYKA 63
            ||::||...:||:||..|....:|..::..::.:.:.     .|.|.|..:|...|:.::..|:.
plant   154 RHEYYQKPEEVVVTVFAKGIPKQNVNIDFGEQILSVVIEVPGEDAYYLQPRLFGKIIPDKCKYEV 218

  Fly    64 FSTKVEITLAKETGIRWENLEE----AIV-------------AAPVKPKAKNWDQLVSEEEKIDE 111
            .|||:||.|||...|.|.:||.    |::             |.|...|.|:||:|.:|.:| .|
plant   219 LSTKIEICLAKADIITWASLEHGKGPAVLPKPNVSSEVSQRPAYPSSKKVKDWDKLEAEVKK-QE 282

  Fly   112 KEAK--GEAALTNLFKKIYSSSSPEVQKAMNKSFSESGGTVLSTNWNEVGKERVTVKPPNGTEFR 174
            |:.|  |:|||...|::||.::..::::||:|||.||.||||||||.|||.:.:...||:|.|.:
plant   283 KDEKLEGDAALNKFFREIYQNADEDMRRAMSKSFVESNGTVLSTNWQEVGTKTIESTPPDGMELK 347

  Fly   175 EWE 177
            :||
plant   348 KWE 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sgt1NP_649783.2 PLN03088 <4..177 CDD:215568 70/196 (36%)
SGT1ANP_001031704.1 PLN03088 1..351 CDD:215568 72/198 (36%)
TPR repeat 35..66 CDD:276809
TPR repeat 71..96 CDD:276809
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.