DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgt1 and SGT1B

DIOPT Version :9

Sequence 1:NP_649783.2 Gene:Sgt1 / 40982 FlyBaseID:FBgn0265101 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_192865.1 Gene:SGT1B / 826728 AraportID:AT4G11260 Length:358 Species:Arabidopsis thaliana


Alignment Length:198 Identity:77/198 - (38%)
Similarity:112/198 - (56%) Gaps:25/198 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RHDWYQSETKVVITVLLKNAVDKNYAVEITQKRVHMTAD-----GYELDLKLLHPIVVERSSYKA 63
            ||::||...:.|:|:..|....:|..||..::.:.:..|     .|.|..:|...|:.|:..::.
plant   161 RHEFYQKPEEAVVTIFAKKVPKENVTVEFGEQILSVVIDVAGEEAYHLQPRLFGKIIPEKCRFEV 225

  Fly    64 FSTKVEITLAKETGIRWENLE--------------EAIVAAPVKPK---AKNWDQLVSEEEKIDE 111
            .||||||.|||...|.|.:||              .|:...||.|.   ||:||:|.:|.:| .|
plant   226 LSTKVEIRLAKAEIITWASLEYGKGQSVLPKPNVSSALSQRPVYPSSKPAKDWDKLEAEVKK-QE 289

  Fly   112 KEAK--GEAALTNLFKKIYSSSSPEVQKAMNKSFSESGGTVLSTNWNEVGKERVTVKPPNGTEFR 174
            |:.|  |:||:...|..||||:..::::||||||:||.||||||||.|||.::|...||:|.|.:
plant   290 KDEKLDGDAAMNKFFSDIYSSADEDMRRAMNKSFAESNGTVLSTNWKEVGTKKVESTPPDGMELK 354

  Fly   175 EWE 177
            :||
plant   355 KWE 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sgt1NP_649783.2 p23_CS_SGT1_like 6..84 CDD:107223 25/82 (30%)
SGS 97..176 CDD:282811 41/80 (51%)
SGT1BNP_192865.1 PLN03088 1..358 CDD:215568 77/198 (39%)
TPR repeat 2..30 CDD:276809
TPR repeat 35..65 CDD:276809
TPR repeat 70..95 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 88 1.000 Domainoid score I2718
eggNOG 1 0.900 - - E1_COG5091
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4877
Inparanoid 1 1.050 132 1.000 Inparanoid score I1865
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426397at2759
OrthoFinder 1 1.000 - - FOG0004070
OrthoInspector 1 1.000 - - otm3211
orthoMCL 1 0.900 - - OOG6_102530
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2822
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.730

Return to query results.
Submit another query.