DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgt1 and sugt1

DIOPT Version :9

Sequence 1:NP_649783.2 Gene:Sgt1 / 40982 FlyBaseID:FBgn0265101 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001016156.1 Gene:sugt1 / 548910 XenbaseID:XB-GENE-919559 Length:330 Species:Xenopus tropicalis


Alignment Length:194 Identity:87/194 - (44%)
Similarity:124/194 - (63%) Gaps:23/194 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RHDWYQSETKVVITVLLKNAVDKNYAVEITQKR--VHM---TADGYELDLKLLHPIVVERSSYKA 63
            ||||||:|:.::|||::||....|..:..:::.  |:|   :.:.|.|:|.|||.||.::|.:|.
 Frog   139 RHDWYQTESHIIITVMIKNVQKNNVHIRFSERELTVNMSLPSGENYSLNLHLLHAIVPDQSIFKV 203

  Fly    64 FSTKVEITLAKETGIRWENLE------------EAIVAAPVKPK-AKNWDQLV---SEEEKIDEK 112
            .||||||.|.|...:|||.||            |::...|.... .||||:||   .||||.::.
 Frog   204 LSTKVEIKLKKTEAMRWETLEGKADSQVKHFTQESMHKYPSSSHYTKNWDKLVGQIKEEEKNEKL 268

  Fly   113 EAKGEAALTNLFKKIYSSSSPEVQKAMNKSFSESGGTVLSTNWNEVGKERVTVKPPNGTEFREW 176
            |  |:|||..||::|||..:.||::||||||.|||||||||||.:|||::|.|.||:..|::::
 Frog   269 E--GDAALNQLFQQIYSDGNDEVKRAMNKSFMESGGTVLSTNWTDVGKKKVDVNPPDDMEWKQY 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sgt1NP_649783.2 p23_CS_SGT1_like 6..84 CDD:107223 34/82 (41%)
SGS 97..176 CDD:282811 47/81 (58%)
sugt1NP_001016156.1 PLN03088 15..330 CDD:330826 87/192 (45%)
TPR repeat 38..68 CDD:276809
TPR repeat 73..98 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7367
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4877
Inparanoid 1 1.050 155 1.000 Inparanoid score I4209
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426397at2759
OrthoFinder 1 1.000 - - FOG0004070
OrthoInspector 1 1.000 - - oto102414
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R491
SonicParanoid 1 1.000 - - X2822
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.