DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgt1 and cacybp

DIOPT Version :9

Sequence 1:NP_649783.2 Gene:Sgt1 / 40982 FlyBaseID:FBgn0265101 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001011170.1 Gene:cacybp / 496588 XenbaseID:XB-GENE-1014297 Length:226 Species:Xenopus tropicalis


Alignment Length:160 Identity:45/160 - (28%)
Similarity:69/160 - (43%) Gaps:39/160 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 HDWYQSETKVVITVLLKNAVDKNYAVEITQKRVHMTADGYELDLK-------------LLHPIVV 56
            :.|.|||..|.|.:.| |.|....|..:   :||.:...:||.:|             ||.||..
 Frog    77 YGWDQSEKFVKIYITL-NGVQNIPAANV---QVHFSERSFELLVKDLDGKNHTMTVNNLLKPISP 137

  Fly    57 ERSSYKAFSTKVEITLAKETGIRWENLEEAIVAAPVKPKAKNWDQLVSEEEKIDEKEA---KGE- 117
            |.|:.|..:..|.|...|::..:||.|.:                 |.::.|..||.|   .|: 
 Frog   138 EGSTKKVKTDTVLIMCRKKSENKWEFLTQ-----------------VEKQTKEREKPALDTDGDP 185

  Fly   118 -AALTNLFKKIYSSSSPEVQKAMNKSFSES 146
             |.|.|:.||||.....::::.:||::.||
 Frog   186 SAGLMNVLKKIYDDGDDDMKRTLNKAWVES 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sgt1NP_649783.2 p23_CS_SGT1_like 6..84 CDD:107223 27/90 (30%)
SGS 97..176 CDD:282811 17/55 (31%)
cacybpNP_001011170.1 Siah-Interact_N 5..74 CDD:370252
p23_CacyBP 74..165 CDD:107225 27/91 (30%)
PLN03088 <155..215 CDD:215568 19/76 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.