DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgt1 and cacybp

DIOPT Version :9

Sequence 1:NP_649783.2 Gene:Sgt1 / 40982 FlyBaseID:FBgn0265101 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_998052.1 Gene:cacybp / 405823 ZFINID:ZDB-GENE-040426-2579 Length:227 Species:Danio rerio


Alignment Length:173 Identity:49/173 - (28%)
Similarity:72/173 - (41%) Gaps:54/173 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QSETKVV-ITVLLKN----AVDKNYAVEITQKRVH----------MTADGY-----ELDLK---- 49
            ::||.|. .||.:.|    ..||...:.||.|.||          .|..|:     :||.|    
Zfish    62 KTETTVKGYTVKINNYGWDQSDKFVKIYITLKGVHTIPAENVESSFTERGFNTLVKDLDGKNHQM 126

  Fly    50 ----LLHPIVVERSSYKAFSTKVEITLAKETGIRWENLEEAIVAAPVKPKAKNWDQL--VSEEEK 108
                ||.||:...|| |...|.:.:.:.|                  |..||.||.|  |.::.|
Zfish   127 TINNLLFPIIAAESS-KKIKTDMVLIMCK------------------KKSAKKWDCLTQVEKQSK 172

  Fly   109 IDEKEAKGEAA-----LTNLFKKIYSSSSPEVQKAMNKSFSES 146
            ..:|.:.||.|     |.::.||||:....|:::.:||::.||
Zfish   173 EKDKPSMGENADPSEGLMSVLKKIYTDGDDEMKRTINKAWVES 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sgt1NP_649783.2 p23_CS_SGT1_like 6..84 CDD:107223 27/102 (26%)
SGS 97..176 CDD:282811 20/57 (35%)
cacybpNP_998052.1 Siah-Interact_N 10..74 CDD:286164 5/11 (45%)
p23_CacyBP 74..165 CDD:107225 27/109 (25%)
SGS 159..>215 CDD:282811 18/55 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.