DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgt1 and Cacybp

DIOPT Version :9

Sequence 1:NP_649783.2 Gene:Sgt1 / 40982 FlyBaseID:FBgn0265101 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_033916.1 Gene:Cacybp / 12301 MGIID:1270839 Length:229 Species:Mus musculus


Alignment Length:164 Identity:45/164 - (27%)
Similarity:65/164 - (39%) Gaps:46/164 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 HDWYQSETKVVITVLLKNAVDKNYAVEITQKRVHMTADGYELDLK-------------LLHPIVV 56
            :.|.||:..|.|.:.|...    :.|.....:||.|...::|.:|             ||.||.|
Mouse    79 YGWDQSDKFVKIYITLTGV----HQVPTENVQVHFTERSFDLLVKNLNGKNYSMIVNNLLKPISV 139

  Fly    57 ERSSYKAFSTKVEITLAKETGIRWENLEEAIVAAPVKPKAKN--WDQLVSEEEKIDEK------- 112
            |.||.|..:..|.|...|                    ||:|  ||.|...|::..||       
Mouse   140 ESSSKKVKTDTVIILCRK--------------------KAENTRWDYLTQVEKECKEKEKPSYDT 184

  Fly   113 EAKGEAALTNLFKKIYSSSSPEVQKAMNKSFSES 146
            ||.....|.|:.||||.....::::.:||::.||
Mouse   185 EADPSEGLMNVLKKIYEDGDDDMKRTINKAWVES 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sgt1NP_649783.2 p23_CS_SGT1_like 6..84 CDD:107223 24/90 (27%)
SGS 97..176 CDD:282811 19/59 (32%)
CacybpNP_033916.1 Interaction with SIAH1. /evidence=ECO:0000250 2..81 0/1 (0%)
Siah-Interact_N 5..76 CDD:286164
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..60
Interaction with SKP1. /evidence=ECO:0000250 74..229 45/164 (27%)
p23_CacyBP 76..168 CDD:107225 29/112 (26%)
Interaction with S100A6 155..229 22/84 (26%)
SGS 183..>218 CDD:282811 10/34 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.