DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nac and GONST3

DIOPT Version :9

Sequence 1:NP_649782.1 Gene:nac / 40981 FlyBaseID:FBgn0265351 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_177760.1 Gene:GONST3 / 843966 AraportID:AT1G76340 Length:372 Species:Arabidopsis thaliana


Alignment Length:330 Identity:72/330 - (21%)
Similarity:127/330 - (38%) Gaps:38/330 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IFFVVSLYWCTSILTVFVNKHLLSSDTVNLGAPLFMSWFQCVVSTVICFVASRLSRKYPSVFTFP 82
            ::.|.:.|..::.|...:||..:...... ||...|.:|......::|           :.....
plant    35 VYGVAAGYCLSASLLSIINKWAIMKFPYP-GALTAMQYFTSAAGVLLC-----------AQMKLI 87

  Fly    83 EGNPLDIDTFRKILPLSVLYTLMIGANNLSLSYVTVAFYYIGRSLTTVFSVVLTYVILRQRTSFK 147
            |.:.|::.|..:.||.::::.|.:..|:..|.:..|..:.:.||...:|..:...:.|.|  .:.
plant    88 EHDSLNLLTMWRFLPAAMIFYLSLFTNSELLLHANVDTFIVFRSAVPIFVAIGETLFLHQ--PWP 150

  Fly   148 CLLCCGAIVVGF-----WLGVDQESLTEVFSWRGTIFGVLSSLALAMFSIQTKKSLGYVNQEVWL 207
            .:...|::...|     ::..|.:.....:||   ....|.|:.:..  :..|..:..:....|.
plant   151 SVKTWGSLATIFGGSLLYVFTDYQFTIAAYSW---ALAYLVSMTIDF--VYIKHVVMTIGLNTWG 210

  Fly   208 LSYYNNLYSTLLFLPLIIINGELESI---ITYPHLWAS-WFWAAMTLSGLCGFAIGFVTALEIKV 268
            |..||||.:.|||...::|.|||:.|   ||....|.| .....:.||.|.|.||.|......:.
plant   211 LVLYNNLEALLLFPLELLIMGELKKIKHEITDETDWYSLQVVLPVGLSCLFGLAISFFGFSCRRA 275

  Fly   269 TSALTHNISGTAKACAQTVIATQYYHDVRSALWWTSNVVVLVASAAYTRVKQLEMMRQHQ-QRST 332
            .||....:.|...... ||:......|..|....|..::|.:....        |.:|.. ::..
plant   276 ISATGFTVLGIVNKLL-TVVINLMVWDKHSTFVGTLGLLVCMFGGV--------MYQQSTIKKPN 331

  Fly   333 ATQKA 337
            |||:|
plant   332 ATQEA 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nacNP_649782.1 TPT 16..281 CDD:281186 60/271 (22%)
GONST3NP_177760.1 VRG4 42..329 CDD:227402 67/314 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D870214at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.