DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nac and CG14621

DIOPT Version :9

Sequence 1:NP_649782.1 Gene:nac / 40981 FlyBaseID:FBgn0265351 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001285522.1 Gene:CG14621 / 33128 FlyBaseID:FBgn0031183 Length:373 Species:Drosophila melanogaster


Alignment Length:349 Identity:75/349 - (21%)
Similarity:147/349 - (42%) Gaps:75/349 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RLVNKYLKIFFVVSLYWCTSILTVFVNKHLLSSDTVNLGAPLFMSW-FQCVVSTV-IC------- 65
            |..::::.:..::.|:|           :::||....:|..:...: |...|:.| :|       
  Fly     5 RTGSRHIAVVLLMCLFW-----------YVISSSNNVIGKMVLNEFPFPMTVTLVQLCSITLYSG 58

  Fly    66 --FVASRLSRKYPSVFTFPEGNPLDIDTFRKILPLSVLYTLMIGANNLSLSYVTVAFYYIGRSLT 128
              |...|: |||..:     ..|.   .:|.|:||::...|....:::||..|.|::.:..::..
  Fly    59 PFFNLWRI-RKYQDI-----PRPY---YYRLIVPLALGKLLASVTSHISLWKVPVSYAHTVKATM 114

  Fly   129 TVFSVVLTYVILRQRTSFKCLLCCGAIVVGFWLGVDQESLTEV-FSWRGTIFGVLSSLALAMFSI 192
            .:|:||||.|...::......|....|:.|  :|:  .::||: |...|.|..::|::..:|.:|
  Fly   115 PLFTVVLTRVFFGEKQPTLVYLSLLPIITG--VGI--ATVTEISFDMMGLISALISTMGFSMQNI 175

  Fly   193 QTKKSLGYVNQEVWLLSYYNNLYSTLLFLPLIIINGELESIITYPH-------------LWA--- 241
            .:||.|...|.....|.:.....|..:||||.:.   ::|...:.|             |:|   
  Fly   176 FSKKVLKDTNIHHLRLLHLLGKLSLFIFLPLWLY---MDSFAVFRHTAIKNLDYRVIALLFADGV 237

  Fly   242 -SWFWAAMTLSGLCGFAIGFVTALEIKVTSALTHNISGTAKACAQTVIATQYYHDVRSALWWTSN 305
             :|      |..:..|::       :.:.:.||:.::..:|..  .|||.... .:.:.:.|.:.
  Fly   238 LNW------LQNIIAFSV-------LSLVTPLTYAVASASKRI--FVIAVSLL-ILGNPVTWVNC 286

  Fly   306 V---VVLVASAAYTRVKQLEMMRQ 326
            |   :.:|....|.|.|||...|:
  Fly   287 VGMTLAIVGVLCYNRAKQLTRGRE 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nacNP_649782.1 TPT 16..281 CDD:281186 61/293 (21%)
CG14621NP_001285522.1 TPT 13..300 CDD:281186 68/329 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464377
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11132
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.