powered by:
Protein Alignment mRpL1 and RPL1A
DIOPT Version :9
Sequence 1: | NP_524275.1 |
Gene: | mRpL1 / 40980 |
FlyBaseID: | FBgn0037566 |
Length: | 354 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_015104.1 |
Gene: | RPL1A / 855881 |
SGDID: | S000006141 |
Length: | 217 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 72 |
Identity: | 16/72 - (22%) |
Similarity: | 31/72 - (43%) |
Gaps: | 23/72 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 178 ASLVGGVELIKDITSGELLLSDYQYVIAHPNILAELVALRGLMKRKFPNPKSETLGTNLAEMIVK 242
|..||.||:.:|:...::|:|...:| .|:|:.: .|:..::||
Yeast 166 AVAVGNVEMEEDVLVNQILMSVNFFV--------------SLLKKNW---------QNVGSLVVK 207
Fly 243 FSSGISY 249
.|.|.::
Yeast 208 SSMGPAF 214
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0081 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.