DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL1 and RPL1A

DIOPT Version :9

Sequence 1:NP_524275.1 Gene:mRpL1 / 40980 FlyBaseID:FBgn0037566 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_015104.1 Gene:RPL1A / 855881 SGDID:S000006141 Length:217 Species:Saccharomyces cerevisiae


Alignment Length:72 Identity:16/72 - (22%)
Similarity:31/72 - (43%) Gaps:23/72 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 ASLVGGVELIKDITSGELLLSDYQYVIAHPNILAELVALRGLMKRKFPNPKSETLGTNLAEMIVK 242
            |..||.||:.:|:...::|:|...:|              .|:|:.:         .|:..::||
Yeast   166 AVAVGNVEMEEDVLVNQILMSVNFFV--------------SLLKKNW---------QNVGSLVVK 207

  Fly   243 FSSGISY 249
            .|.|.::
Yeast   208 SSMGPAF 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL1NP_524275.1 rplA_mito 97..246 CDD:273480 15/67 (22%)
RPL1ANP_015104.1 Ribosomal_L1 1..217 CDD:412308 16/72 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0081
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.