DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL1 and MRPL1

DIOPT Version :9

Sequence 1:NP_524275.1 Gene:mRpL1 / 40980 FlyBaseID:FBgn0037566 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_010401.1 Gene:MRPL1 / 851694 SGDID:S000002523 Length:285 Species:Saccharomyces cerevisiae


Alignment Length:277 Identity:59/277 - (21%)
Similarity:106/277 - (38%) Gaps:88/277 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SAVSEAARKGTREKARKKKVKVEVKKVGFIPHNQRNKKINVKRADKHVDDSWKQVPKDDCYVGRY 91
            :|:|..|...|:::|:|:::|..|:           :|...||            |....     
Yeast    35 AAMSSNAPSLTKDQAKKRELKRLVQ-----------RKAEAKR------------PATAS----- 71

  Fly    92 YRWPVY-SVQEAIQCHR--ETHHPSMYNVPN-----------APLNLDIELNMQAEKITRFVDNF 142
               |:| .|.:|::..|  |...|......|           |||:..:..    .|..|::   
Yeast    72 ---PLYMPVTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTF----PKPLRYI--- 126

  Fly   143 QRMAMIPHKFDHGEERKIIVFTKGNNEVLEAREAGAS-LVGGVELIKDITSGELLLSDYQYVIAH 206
                            ||..||...:::.|.||...: |:||.:|:..|.|||:.: |:....|.
Yeast   127 ----------------KIAAFTNDESKLEELREKYPNHLIGGADLVAKIKSGEISV-DFDKAFAT 174

  Fly   207 PNI-------LAELVALRGLMKRKFPNPKSETLGTNLAEMIVKFSSGISYSAAKDEYQQNFGLIT 264
            |:|       :|.::..||::    |:.|..|:..::       ||.:..|.....::|....|:
Yeast   175 PDIVPALQSQVARILGPRGVL----PSVKKGTVSDDI-------SSLLQESLGSMPFRQRGNSIS 228

  Fly   265 ASVGTLDMDVQKLEENI 281
            ..||......:::.:||
Yeast   229 IGVGKCYFTDREILQNI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL1NP_524275.1 rplA_mito 97..246 CDD:273480 38/170 (22%)
MRPL1NP_010401.1 rplA_mito 75..216 CDD:273480 39/175 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0081
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100942
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4035
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.