DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL1 and MRPL1

DIOPT Version :9

Sequence 1:NP_524275.1 Gene:mRpL1 / 40980 FlyBaseID:FBgn0037566 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_064621.3 Gene:MRPL1 / 65008 HGNCID:14275 Length:325 Species:Homo sapiens


Alignment Length:326 Identity:89/326 - (27%)
Similarity:158/326 - (48%) Gaps:53/326 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 HLSAVSEAA---RKGTREKARKKKVKVEVKKVGFIPHNQRNKKINVKRADKHVDDSWKQVPKDDC 86
            |.:|.:::|   :||.:||...:| |.|::|:...|:.:..                   |:||.
Human    42 HFAAATKSAKKTKKGAKEKTPDEK-KDEIEKIKAYPYMEGE-------------------PEDDV 86

  Fly    87 YVGRYYRWPVYSVQEAIQCHRETHHPSMYNV-----PNAPLNLDIELNMQAEKITRFVDNFQRMA 146
            |:.|.|...:|.|::|:      |....:.:     |...:.||:.|:|...| .:.|:.|..:.
Human    87 YLKRLYPRQIYEVEKAV------HLLKKFQILDFTSPKQSVYLDLTLDMALGK-KKNVEPFTSVL 144

  Fly   147 MIPHKFDHGEERKIIVFTKGNNEVLEAREAGASLVGGVELIKDITSGELLLSDYQYVIAHPNILA 211
            .:|:.| ..|..|:.|||:..:||..|.|.||:..||..||:.|...|::...|   :|.|.|:.
Human   145 SLPYPF-ASEINKVAVFTENASEVKIAEENGAAFAGGTSLIQKIWDDEIVADFY---VAVPEIMP 205

  Fly   212 ELVALRGLMKRKFPNPKSETLGTNLAEMIVKFSSGISYSAAKDEYQQNFGLITASVGTLDMDVQK 276
            ||..||..:.:|:|.....::|.::.:|:..|.:|  :....||.::||  :...:.||||...:
Human   206 ELNRLRKKLNKKYPKLSRNSIGRDIPKMLELFKNG--HEIKVDEERENF--LQTKIATLDMSSDQ 266

  Fly   277 LEENIKFLLQDINTMRPKREGRFITRVLLKSPPSSE-QLKIDPFVYVPEMWDKSTAKVKRDGAKK 340
            :..|::.::.::...||...|.|:.|..|:|..|.. .|||||.  :|:       :||.:.::|
Human   267 IAANLQAVINEVCRHRPLNLGPFVVRAFLRSSTSEGLLLKIDPL--LPK-------EVKNEESEK 322

  Fly   341 Q 341
            :
Human   323 E 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL1NP_524275.1 rplA_mito 97..246 CDD:273480 44/153 (29%)
MRPL1NP_064621.3 rplA_mito 97..240 CDD:273480 44/153 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I8132
eggNOG 1 0.900 - - E1_COG0081
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I4885
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50176
OrthoDB 1 1.010 - - D1432931at2759
OrthoFinder 1 1.000 - - FOG0006284
OrthoInspector 1 1.000 - - oto91220
orthoMCL 1 0.900 - - OOG6_100942
Panther 1 1.100 - - LDO PTHR23105
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4035
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.