DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL1 and mrpl1

DIOPT Version :9

Sequence 1:NP_524275.1 Gene:mRpL1 / 40980 FlyBaseID:FBgn0037566 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001191062.1 Gene:mrpl1 / 553284 ZFINID:ZDB-GENE-060526-311 Length:316 Species:Danio rerio


Alignment Length:315 Identity:98/315 - (31%)
Similarity:163/315 - (51%) Gaps:27/315 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QSILSSMRALALRQSTVEPLRLLHLSAVSEAARKGTREKARKKKVKVEVKKVGFIPHNQRNKKIN 66
            ||:|.:.||.::..:::...|.....:.:...:|..:|:|.|:||   ||:...|....|:|...
Zfish    16 QSLLFTNRAPSVSCNSLTAHRQQSARSYAATKKKEKKEEAVKEKV---VKERKIIDDKDRHKPFG 77

  Fly    67 VKRADKHVDDSWKQVPKDDCYVGRYYRWPVYSVQEAIQCHRETHHPSMYNVPNAPLNLDIELNMQ 131
            :        .:|  .|.||.|:.|||..|:|.:..||.. .::.....::..|.|:.:::.|||:
Zfish    78 L--------TAW--APVDDVYMVRYYPRPLYELTVAIDM-LKSFQKLDFSAENQPIYINLRLNMK 131

  Fly   132 AEKITRFVDNFQRMAMIPHKFDHGEERKIIVFTKGNNEVLEAREAGASLVGGVELIKDITSGELL 196
            .|| .|.:|.|.|...:||.| ..:..|::|||:..::...|.|.||::.|||||.:.|.:.|:.
Zfish   132 LEK-KRKLDPFVRTIHLPHPF-KSDINKVVVFTEKPDQARIALENGAAVAGGVELFEKILADEIT 194

  Fly   197 LSDYQYVIAHPNILAELVALRGLMKRKFPNPKSETLGTNLAEMIVKFSSGISYSAAKDEYQQNFG 261
            ...|   :|.|:||.:||.|:..:::|||..|..|:|.|:..|:..|.:|..| ..:|.|     
Zfish   195 ADFY---LAEPDILPKLVPLKNKLRKKFPKSKRGTVGINIPRMLELFKTGHEY-IVEDIY----- 250

  Fly   262 LITASVGTLDMDVQKLEENIKFLLQDINTMRPKREGRFITRVLLKSPPSSEQLKI 316
             :...|.||||..:.:.|||..:|:|:.:.:|...|..|.|.::.| .|||.|.:
Zfish   251 -VNTEVATLDMPKEHILENIHTILKDVASHKPAEFGPIIDRAIVCS-RSSEGLHL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL1NP_524275.1 rplA_mito 97..246 CDD:273480 49/148 (33%)
mrpl1NP_001191062.1 Ribosomal_L1 98..241 CDD:294228 49/148 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I7208
eggNOG 1 0.900 - - E1_COG0081
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4737
OMA 1 1.010 - - QHG50176
OrthoDB 1 1.010 - - D1432931at2759
OrthoFinder 1 1.000 - - FOG0006284
OrthoInspector 1 1.000 - - oto39702
orthoMCL 1 0.900 - - OOG6_100942
Panther 1 1.100 - - LDO PTHR23105
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.