DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL1 and Rpl10a

DIOPT Version :9

Sequence 1:NP_524275.1 Gene:mRpL1 / 40980 FlyBaseID:FBgn0037566 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_035417.2 Gene:Rpl10a / 19896 MGIID:1343877 Length:217 Species:Mus musculus


Alignment Length:236 Identity:47/236 - (19%)
Similarity:85/236 - (36%) Gaps:69/236 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EAARK---GTREKARKKKVKVEVKKVGFIPHNQRNKKINVKRADKHVDDSW------KQVPKDDC 86
            ||.|:   |.:.|.||....||:             :|::|..|...|..:      |..|:   
Mouse    12 EAVREVLHGNQRKRRKFLETVEL-------------QISLKNYDPQKDKRFSGTVRLKSTPR--- 60

  Fly    87 YVGRYYRWPVYSVQEAIQC----HRETHHPSMYNVPNAPLNLDIE----LNMQ-------AEKIT 136
                    |.:||     |    .:........::|    ::|||    ||..       |:|..
Mouse    61 --------PKFSV-----CVLGDQQHCDEAKAVDIP----HMDIEALKKLNKNKKLVKKLAKKYD 108

  Fly   137 RFVDNFQRMAMIPHKFDHGEERK---IIVFTKGNNEVLEAREAGASLVGGVE--LIKDITSGELL 196
            .|:.:...:..||.....|..:.   ..:.|...|.|.:..|..:::...::  |...:..|.:.
Mouse   109 AFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVK 173

  Fly   197 LSDYQYVIAHPNILAELVALRGLMKRKFPNPKS----ETLG 233
            ::|.:.|.   ||...:..|..|:|:.:.|.::    .|:|
Mouse   174 MTDDELVY---NIHLAVNFLVSLLKKNWQNVRALYIKSTMG 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL1NP_524275.1 rplA_mito 97..246 CDD:273480 31/161 (19%)
Rpl10aNP_035417.2 Ribosomal_L1 2..217 CDD:412308 47/236 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0081
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.