DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL1 and LOC103690888

DIOPT Version :9

Sequence 1:NP_524275.1 Gene:mRpL1 / 40980 FlyBaseID:FBgn0037566 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_008771696.1 Gene:LOC103690888 / 103690888 RGDID:9343299 Length:217 Species:Rattus norvegicus


Alignment Length:199 Identity:41/199 - (20%)
Similarity:75/199 - (37%) Gaps:33/199 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LNLDIEL-NMQAEKITRFVDNFQRMAMIPHKF--------DHGEERKIIVFTKGNNEVLEAREAG 177
            :.|.|.| |...:|..||....:..:....||        .|.:|.|.:.....:.|.|:.....
  Rat    32 VELQISLKNYHPQKDKRFSGTIRLKSTPCSKFSVCVLGDQQHCDEAKAVDIPAMDIEALKKLNKN 96

  Fly   178 ASLVGGVELIKDITSGELLLSDYQYVIAHPNILAELVAL--RGLMK-RKFPNPKSETLGTNLAEM 239
            ..||            :.|...|...:|..:::.::..:  .||.| .|||:  ..|...|:...
  Rat    97 KKLV------------KKLAKKYDVFLASESLIKQIPRILGPGLNKVGKFPS--LLTHNENMVAK 147

  Fly   240 IVKFSSGISYSAAKDEYQQNFGLITASVGTLDMDVQKLEENIKFLLQDINTMRPKREGRFITRVL 304
            :.|..|.|.:...|      ...:..:||.::|...:|..||...:..:.::. |:..:.:..:.
  Rat   148 VDKVKSTIKFQMKK------VLRLAVAVGHVNMTNGELVYNIHLAVNFLVSLL-KKNWQNLQALY 205

  Fly   305 LKSP 308
            :|||
  Rat   206 IKSP 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL1NP_524275.1 rplA_mito 97..246 CDD:273480 28/135 (21%)
LOC103690888XP_008771696.1 Ribosomal_L1 2..208 CDD:412308 38/196 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0081
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.