| Sequence 1: | NP_649778.1 | Gene: | Nazo / 40976 | FlyBaseID: | FBgn0037562 | Length: | 140 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_024307502.1 | Gene: | C19orf12 / 83636 | HGNCID: | 25443 | Length: | 195 | Species: | Homo sapiens |
| Alignment Length: | 137 | Identity: | 38/137 - (27%) |
|---|---|---|---|
| Similarity: | 75/137 - (54%) | Gaps: | 7/137 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MDSAISEIINALAILADDKNIQLTIKEAGKGAAICAGAALIGGLLLGPRGLALGGAIGGLTAYGL 65
Fly 66 TEGNFKSLSEVILNDLTESQRRELEQHVIRAISEVRNVRVRDVAR---LILNNRHVQEVALEAVK 127
Fly 128 SYITDRM 134 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 103 | 1.000 | Domainoid score | I6785 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 103 | 1.000 | Inparanoid score | I4970 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG50112 | |
| OrthoDB | 1 | 1.010 | - | - | D1474873at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0003581 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR31493 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X2933 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 8 | 8.170 | |||||